KEGG   Saccharomyces cerevisiae (budding yeast): YDL035C
Entry
YDL035C           CDS       T00005                                 

Gene name
GPR1
Definition
(RefSeq) Gpr1p
  KO
K12762  G protein-coupled receptor GPR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDL035C (GPR1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YDL035C (GPR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sce04030]
    YDL035C (GPR1)
G protein-coupled receptors [BR:sce04030]
 Others
  Others
   cAMP signaling
    YDL035C (GPR1)
SSDB
Motif
Pfam: Git3 GPR_Gpa2_C
Other DBs
NCBI-GeneID: 851527
NCBI-ProteinID: NP_010249
SGD: S000002193
UniProt: Q12361
LinkDB
Position
IV:complement(389172..392057)
AA seq 961 aa
MITEGFPPNLNALKGSSLLEKRVDSLRQLNTTTVNQLLGLPGMTSTFTAPQLLQLRIIAI
TASAVSLIAGCLGMFFLSKMDKRRKVFRHDLIAFLIICDFLKAFILMIYPMIILINNSVY
ATPAFFNTLGWFTAFAIEGADMAIMIFAIHFAILIFKPNWKWRNKRSGNMEGGLYKKRSY
IWPITALVPAILASLAFINYNKLNDDSDTTIILDNNNYNFPDSPRQGGYKPWSAWCYLPP
KPYWYKIVLSWGPRYFIIIFIFAVYLSIYIFITSESKRIKAQIGDFNHNVLEEEKEKKKL
FGLGHWGKAKWYFRSYFKLPLLHLLRNLKNFFTISFIDPNEETDDSGSSNGTFNFGESSN
EIPTLFRKTNTGSDENVSASGGVRLLDYNSAKPLDMSKYAMSEQPDLERNNPFDCENDIT
LNPSELVSKQKEHKVTFSVENEGLDTRKSSMLGHQTFSCQNSLESPLAMYDNKNDNSDIT
SNIKEKGGIINNNSNNDDDDNNNNNDNDNDNNNSNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNSNNIKNNVDNNNTNPADNIPTLSNEAFTPSQQFSQERVNNNADRCENSSFTNVQQH
FQAQTYKQMKKRRAQIQKNLRAIFIYPLSYIGIWLFPIIADALQYNHEIKHGPTMWVTYI
DTCVRPLSCLVDVIVYLFKEKPWNYSWAKTESKYLIEKYILKGELGEKEILKFCHSNWGK
RGWYYRGKWKKRKCWKYSTNPLKRILWFVERFFKQLFELKLHFSFYDNCDDFEYWENYYS
AKDSNDNKRTESDETKTNSSDRSLPSNSLELQAMLNNITAEEVEVPLFWRIIHHIPMLGG
IDLDELNRLLKIRYNNDHFSLPGLKFALNQNKSHDKHQDVSTNSMVKSSFFSSNIVTNDD
ENSIEEDKNLRYSDASASENYLVKPTIPGTTPDPIIEAQNDNDSSDSSGIDLIAFLRNGP
L
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgataactgagggatttcccccgaatttaaacgcgttgaaagggtcatccttactagaa
aagagagttgattctctccgacagcttaacactaccacggttaaccagctgctggggttg
ccggggatgacctctacattcacggctccgcaactgttgcagttaagaataatagctata
actgcgtctgccgtgtcccttattgccggttgcctcggaatgttcttcctttctaaaatg
gataagagacgaaaagtcttcagacatgatctcatcgcatttttgataatttgcgacttt
cttaaagcttttattctgatgatttatcccatgattatccttattaataatagtgtgtat
gcaacacctgcattttttaataccttgggttggtttacggcctttgccatcgaaggtgca
gacatggccataatgatattcgccatacattttgctattttgatcttcaagcctaattgg
aaatggcgaaataaaagatcgggaaatatggagggtggcttgtacaaaaaaaggtcatat
atctggccaattactgcattagtacctgccattttagcaagcttagccttcattaattat
aataaactcaatgacgattctgacaccactattatactggataataataactacaacttt
cccgattctcccaggcaaggtggctacaaaccttggagtgcatggtgctatttaccaccc
aagccgtactggtataaaattgttttaagctggggtcccagatatttcattattattttc
atatttgcagtctacctcagtatttatattttcattaccagtgaaagtaaaagaattaaa
gcgcaaattggagactttaaccataacgtactagaggaagagaaagaaaagaaaaaatta
tttgggctcggtcactggggaaaagccaaatggtatttcagatcctattttaaattgcca
ttgctacatcttttgagaaatttaaagaattttttcaccatttcgttcatagatccgaat
gaggaaacagacgattcaggtagtagtaatggaactttcaattttggtgagagttcgaat
gagatacctacactattcagaaaaacaaatacaggtagtgatgagaatgtctcggcaagt
ggtggagttcgcttacttgactataacagtgctaaaccactcgatatgtccaaatatgca
atgtctgaacagccagatttggaaagaaataatccttttgattgtgaaaatgacatcaca
ctcaatccttcggaactagtatccaagcaaaaggagcataaagttacttttagtgttgaa
aatgaaggactggatacaagaaaaagttcaatgctgggacatcagactttctcttgccaa
aattctctagaatctcctttagcaatgtatgataataagaacgataacagcgacataact
agtaacattaaggaaaaaggaggcatcatcaacaacaacagtaacaacgacgacgacgac
aacaacaacaataacgataacgataacgataacaataatagcaataataataataacaat
aataataataacaataataataataacaataataataacaataacaacaacaacaacaat
aataataataatagtaataatattaaaaataacgttgataacaataatactaatccagcc
gataatattcctacactttctaatgaagcatttactccgtctcaacaattttcacaggag
agagtgaataataatgcagacagatgcgaaaattcaagtttcaccaacgtacaacagcat
ttccaagcccaaacctacaaacaaatgaaaaaacgtagggcacaaattcaaaagaatcta
agggcaatattcatttatccactgtcgtatattgggatatggcttttccccatcattgca
gatgcgttgcaatacaatcatgaaataaagcatgggcctaccatgtgggtgacatacatt
gacacttgcgttcgaccattaagttgtctcgtcgacgtcattgtttacctgttcaaggaa
aaaccttggaactattcatgggcaaaaacagaatcaaaatatctcattgaaaaatatatt
ctgaaaggagagcttggtgaaaaggaaattctgaagttttgtcacagcaattgggggaaa
agaggttggtattatcgtggtaagtggaagaaaagaaaatgctggaaatattctacaaac
cctctgaagcgtatactgtggtttgttgaacgcttctttaaacaattgtttgaactaaaa
ctacactttagtttttatgacaattgtgacgattttgaatactgggaaaactactattca
gccaaagattcaaacgataataaacgcacagaatctgatgagactaaaacgaatagtagc
gatcgctcccttccatcaaattcacttgaactacaggcaatgcttaataacatcacggcc
gaagaggttgaagtgcccttgttttggaggatcattcatcatattccaatgcttggcgga
atagatcttgatgagttaaacagattgttgaaaatacggtacaataacgaccatttttct
ctacccgggttgaaatttgcattaaaccaaaataaaagtcacgataaacatcaggacgtc
tcaactaacagtatggtcaaatccagcttcttttcaagcaatattgtcacaaacgatgat
gagaatagcattgaagaggataagaatttacgctattcagatgctagtgcatctgaaaat
tatctggtcaagcccacaataccaggtacgactcctgatccaataattgaggcgcagaac
gataatgatagtagtgatagtagcggcatagatttgatagccttcttaagaaatggacca
ttataa

DBGET integrated database retrieval system