KEGG   Saccharomyces cerevisiae (budding yeast): YER012W
Entry
YER012W           CDS       T00005                                 
Symbol
PRE1
Name
(RefSeq) proteasome core particle subunit beta 4
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    YER012W (PRE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YER012W (PRE1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YER012W (PRE1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     YER012W (PRE1)
Peptidases and inhibitors [BR:sce01002]
 Threonine peptidases
  Family T1: proteasome family
   YER012W (PRE1)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    YER012W (PRE1)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 856731
NCBI-ProteinID: NP_010928
SGD: S000000814
UniProt: P22141
Structure
LinkDB
Position
V:177835..178431
AA seq 198 aa
MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI
QANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID
YLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVI
VKIVDKDGIRQVDDFQAQ
NT seq 597 nt   +upstreamnt  +downstreamnt
atggatattattctgggcatccgtgtacaggattctgtcattctagcgtcttctaaggca
gtcacaagaggtatttctgttttaaaagattctgatgataaaacgagacaattatcgcca
catacattgatgagttttgccggtgaagctggtgacaccgttcaattcgccgagtacatt
caagccaatatccaattatactccattagagaagattatgagctctctccacaagcagta
tctagttttgttaggcaagaattagccaagtcaattaggtcgagaagaccataccaagtc
aacgtattgattggaggctatgacaaaaagaagaacaaaccggaactatatcaaattgac
tacttgggtactaaagtcgaattaccctatggtgctcatggttactcggggttttacaca
ttctctttactagatcatcattatagacctgatatgactactgaggagggtttagattta
ttaaaactatgtgtacaagagcttgaaaaaagaatgccaatggacttcaagggcgtcatt
gttaaaatcgtggataaagatggcataagacaagtagatgacttccaggcacagtga

DBGET integrated database retrieval system