KEGG   Saccharomyces cerevisiae (budding yeast): YER020W
Entry
YER020W           CDS       T00005                                 

Gene name
GPA2, SSP101
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YER020W (GPA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YER020W (GPA2)
   04031 GTP-binding proteins [BR:sce04031]
    YER020W (GPA2)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YER020W (GPA2)
GTP-binding proteins [BR:sce04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    YER020W (GPA2)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA HCV_capsid FtsK_SpoIIIE AAA_29
Other DBs
NCBI-GeneID: 856741
NCBI-ProteinID: NP_010937
SGD: S000000822
UniProt: P10823
LinkDB
Position
V:195168..196517
AA seq 449 aa
MGLCASSEKNGSTPDTQTASAGSDNVGKAKVPPKQEPQKTVRTVNTANQQEKQQQRQQQP
SPHNVKDRKEQNGSINNAISPTATANTSGSQQINIDSALRDRSSNVAAQPSLSDASSGSN
DKELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTR
FNVNLEPECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASK
FYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQ
RSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSV
VLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRFVQLNRANLSIYPHVTQA
TDTSNIRLVFAAIKETILENTLKDSGVLQ
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgggtctctgcgcatcttcagaaaagaacggcagcactcctgacacgcagaccgccagc
gctggtagtgacaacgttggcaaagcgaaggtaccaccaaagcaggagccacagaagact
gtgagaacagtcaacacagcaaatcaacaagaaaagcaacaacagaggcagcagcagccg
tctccgcataatgttaaggaccgcaaggagcaaaacgggagcattaataacgcgatatct
cccacggctacggcaaatacaagcggatcgcaacagatcaatatcgactctgccctgaga
gacaggtcgagtaacgttgcagcacaaccatcattgtcggacgcttcaagtggcagcaac
gacaaagaactgaaagtgctactgctgggtgccggtgaaagtggtaagtccacggtattg
cagcagttgaagattttacaccagaacgggtttagcgagcaggaaattaaagagtacatc
cccttgatctatcagaatctattggaaattggcaggaacctcatccaggcgagaacaagg
tttaacgtcaacttggaaccggagtgtgaactgacgcaacaagacctgtcgagaaccatg
tcctatgaaatgcccaataactacacgggccaattcccggaagatatcgcgggcgtaata
tctacgttgtgggccttgccctcaacacaagatttagtcaatgggcctaacgcatcgaag
ttctatctaatggactcgactccttacttcatggaaaatttcaccaggatcacttcgccc
aattacagacccacccagcaggacatattaagatcgagacagatgacgtcagggattttt
gacaccgtcattgatatggggtcggatatcaagatgcatatttacgacgtgggtggacag
cgttccgaaagaaaaaaatggatacactgcttcgacaatgtcactctggtcatattttgc
gtttctctatcggagtacgaccagacgctgatggaggacaagaaccagaacaggtttcag
gaatcgctggtgcttttcgataatattgtcaacagtagatggttcgcgcgcacgtctgtc
gtactctttctgaataaaatcgacctttttgctgaaaaactaagcaaagtgcctatggaa
aattacttcccagactacaccggcgggtcagacatcaacaaggctgctaagtacatactc
tggaggtttgttcagttaaacagggcgaatctaagcatatatcctcacgtgacacaggcc
acagacacgtcgaatataagattagtatttgccgccatcaaagaaacaattttggaaaat
acattgaaagactctggagtgttacaatga

DBGET integrated database retrieval system