KEGG   Saccharomyces cerevisiae (budding yeast): YHR118C
Entry
YHR118C           CDS       T00005                                 

Gene name
ORC6
Definition
(RefSeq) origin recognition complex subunit 6
  KO
K02608  origin recognition complex subunit 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YHR118C (ORC6)
   04113 Meiosis - yeast
    YHR118C (ORC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YHR118C (ORC6)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YHR118C (ORC6)
SSDB
Motif
Pfam: ORC6
Other DBs
NCBI-GeneID: 856518
NCBI-ProteinID: NP_011986
SGD: S000001160
UniProt: P38826
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
VIII:complement(344321..345628)
AA seq 435 aa
MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHI
CAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKN
KRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKL
AFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRS
GRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAY
KIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVD
DVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNI
WKKRIEMDLALTEPL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtccatgcaacaagtccaacattgtgtcgcagaagtacttcgactagatccacaagaa
aaaccggactggtcgagcggatatttgaagaagttgactaatgcgacatcgattttatat
aatacttcactgaacaaggtaatgctgaaacaagatgaagaggttgctagatgtcacata
tgtgcatacatagcgtcacagaaaatgaatgaaaaacacatgcctgacctttgctattat
atagacagtattcccttggagccgaaaaaagccaagcatttaatgaaccttttcagacaa
agtttatctaattcttcacctatgaaacaatttgcttggacaccgagccccaaaaagaac
aaacgcagtccagtaaagaacggtgggaggtttacttcttctgatccgaaagagttgagg
aatcaactgtttggtacaccaactaaagttaggaaaagccaaaataatgattcgttcgta
ataccagaactaccccccatgcaaaccaatgaatcgccgtctattactaggagaaagtta
gcatttgaagaggatgaggatgaggatgaagaggaaccaggaaacgacggtttgtcttta
aaaagccatagtaataagagcattactggaaccagaaatgtagattctgatgagtatgaa
aaccatgaaagtgaccctacaagtgaggaagagccattaggtgtgcaagaaagcagaagc
gggagaacgaaacaaaataaggcagttggaaaaccgcaatcagaattgaagacggcaaaa
gccctgaggaaaaggggcagaataccaaattctttgttagtaaagaagtattgcaaaatg
actactgaagaaataatacggctttgcaacgattttgaattaccaagagaagtagcatat
aaaattgtggatgagtacaacataaacgcgtcaagattggtttgcccatggcaattagtg
tgtgggttagtattaaattgtacattcattgtatttaatgaaagaagacgcaaggatcca
agaattgaccattttatagtcagtaagatgtgcagcttgatgttgacgtcaaaagtggat
gatgttattgaatgtgtaaaattagtgaaggaattaattatcggtgaaaaatggttcaga
gatttgcaaattaggtatgatgattttgatggcatcagatacgatgaaattatatttagg
aaactgggatcgatgttacaaaccaccaatattttggtcacagacgaccagtacaatatt
tggaagaaaagaattgaaatggatttggcattaacagaacctttataa

DBGET integrated database retrieval system