KEGG   Saccharomyces cerevisiae (budding yeast): YIL009W
Entry
YIL009W           CDS       T00005                                 

Symbol
FAA3
Name
(RefSeq) long-chain fatty acid-CoA ligase FAA3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00061  Fatty acid biosynthesis
sce00071  Fatty acid degradation
sce01100  Metabolic pathways
sce01212  Fatty acid metabolism
sce04146  Peroxisome
Module
sce_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YIL009W (FAA3)
   00071 Fatty acid degradation
    YIL009W (FAA3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YIL009W (FAA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YIL009W (FAA3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YIL009W (FAA3)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     YIL009W (FAA3)
Lipid biosynthesis proteins [BR:sce01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   YIL009W (FAA3)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   YIL009W (FAA3)
  Exosomal proteins of breast cancer cells
   YIL009W (FAA3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 854808
NCBI-ProteinID: NP_012257
SGD: S000001271
UniProt: P39002
LinkDB
Position
IX:339344..341428
AA seq 694 aa
MSEQHSVAVGKAANEHETAPRRNVRVKKRPLIRPLNSSASTLYEFALECFNKGGKRDGMA
WRDVIEIHETKKTIVRKVDGKDKSIEKTWLYYEMSPYKMMTYQELIWVMHDMGRGLAKIG
IKPNGEHKFHIFASTSHKWMKIFLGCISQGIPVVTAYDTLGESGLIHSMVETESAAIFTD
NQLLAKMIVPLQSAKDIKFLIHNEPIDPNDRRQNGKLYKAAKDAINKIREVRPDIKIYSF
EEVVKIGKKSKDEVKLHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNVFG
WIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGYGSVKTLTNTSTRNCKGDLVEFKPTI
MIGVAAVWETVRKAILEKISDLTPVLQKIFWSAYSMKEKSVPCTGFLSRMVFKKVRQATG
GHLKYIMNGGSAISIDAQKFFSIVLCPMIIGYGLTETVANACVLEPDHFEYGIVGDLVGS
VTAKLVDVKDLGYYAKNNQGELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIVEWTP
KGQLKIIDRRKNLVKTLNGEYIALEKLESVYRSNSYVKNICVYADESRVKPVGIVVPNPG
PLSKFAVKLRIMKKGEDIENYIHDKALRNAVFKEMIATAKSQGLVGIELLCGIVFFDEEW
TPENGFVTSAQKLKRREILAAVKSEVERVYKENS
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgtccgaacaacactctgtcgcagtcggtaaagctgctaatgagcacgagactgcccct
aggagaaatgttagagtcaagaagcggcccttaattagaccattgaactcgtcagcatct
acgctgtatgaatttgccctagagtgtttcaacaagggtggaaaacgagatggtatggct
tggagagatgtcatcgagattcatgagacaaagaaaaccattgtgagaaaggtagacggc
aaggataaatctatagaaaagacatggctgtattatgaaatgtcaccatataaaatgatg
acctaccaggaactgatctgggtgatgcacgatatgggccgtgggctggcaaaaataggc
atcaagcccaatggagaacacaaattccacatcttcgcatctacttcccataaatggatg
aagattttccttggttgcatatcccagggtatccccgtagtaaccgcgtatgatactttg
ggtgagagcggtttgattcactccatggttgaaaccgagtctgctgctattttcactgat
aatcaattattggctaaaatgatagtgcctttgcaatctgctaaagatatcaaatttctt
atccataacgaacctatcgaccccaatgacagaagacaaaacggcaaactttacaaggct
gctaaggatgccattaataagatcagagaagttaggccagacataaaaatttatagtttt
gaagaagttgtcaagataggtaaaaaaagtaaagatgaggtcaaacttcatccacctgag
ccaaaagatttggcttgtatcatgtacacctcgggctcgatcagtgcaccaaaaggtgta
gtattgactcattataatattgtttcgggtatcgctggtgtaggtcacaacgtctttgga
tggatcggctctacagaccgtgttttgtcgttcttgccattggctcatatttttgaactg
gtctttgaattcgaagccttttactggaacggtattcttgggtacggtagtgttaagact
ttgactaatacttcgactcgtaattgtaagggtgacctggttgagtttaagcctactatt
atgatcggtgtggctgccgtttgggaaactgtgagaaaagctattttggaaaagatcagc
gatttaactcccgtactccaaaagattttttggtctgcctatagtatgaaagaaaagagt
gtaccatgcaccgggtttttaagtcgtatggtcttcaagaaagtcagacaagccaccggt
ggtcatcttaagtatattatgaacggtgggtctgcgatcagtattgatgctcagaaattc
ttttctatcgtcctgtgtcctatgattatcggttacggccttactgaaacagttgcgaat
gcttgtgttttggagcctgatcatttcgaatatggtatagttggtgatcttgttggatcg
gtcactgccaaattggtggatgttaaggacctaggttattatgcaaaaaacaatcaaggt
gaattgcttctaaagggtgcgccggtctgttctgaatattataagaatccaatagaaacg
gcggtctctttcacttacgatggatggtttcgtactggtgatattgttgaatggactccc
aagggacaacttaaaattattgatagaagaaagaatttggttaaaaccctaaatggtgaa
tatattgcattagaaaagttagaatctgtttacaggtcaaactcctatgtgaaaaatatc
tgtgtttatgccgatgaaagtagggttaaaccggtgggtattgtggtacccaacccagga
cccctatctaaatttgctgtcaaattgcgtattatgaaaaagggtgaagacatcgaaaac
tatatccatgacaaagcattacgaaatgctgttttcaaagagatgatcgcaacagccaaa
tctcaaggtttggttggtattgaactattatgtggtattgttttctttgatgaagaatgg
acacctgaaaatggctttgtcacatctgctcaaaaattaaagagaagagaaatcttagcc
gctgttaaatcagaagtcgaaagggtttacaaagaaaattcttag

DBGET integrated database retrieval system