KEGG   Saccharomyces cerevisiae (budding yeast): YJL005W
Entry
YJL005W           CDS       T00005                                 

Gene name
CYR1, CDC35, FIL1, HSR1, SRA4, TSM0185
Definition
(RefSeq) adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
sce04113  Meiosis - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YJL005W (CYR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJL005W (CYR1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YJL005W (CYR1)
Enzymes [BR:sce01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     YJL005W (CYR1)
SSDB
Motif
Pfam: PP2C LRR_8 Guanylate_cyc LRR_4 Ad_cyc_g-alpha LRR_9 PP2C_2
Other DBs
NCBI-GeneID: 853452
NCBI-ProteinID: NP_012529
SGD: S000003542
UniProt: P08678
LinkDB
Position
X:425157..431237
AA seq 2026 aa
MSSKPDTGSEISGPQRQEEQEQQIEQSSPTEANDRSIHDEVPKVKKRHEQNSGHKSRRNS
AYSYYSPRSLSMTKSRESITPNGMDDVSISNVEHPRPTEPKIKRGPYLLKKTLSSLSMTS
ANSTHDDNKDHGYALNSSKTHNYTSTHNHHDGHHDHHHVQFFPNRKPSLAETLFKRFSGS
NSHDGNKSGKESKVANLSLSTVNPAPANRKPSKDSTLSNHLADNVPSTLRRKVSSLVRGS
SVHDINNGIADKQIRPKAVAQSENTLHSSDVPNSKRSHRKSFLLGSTSSSSSRRGSNVSS
MTNSDSASMATSGSHVLQHNVSNVSPTTKSKDSVNSESADHTNNKSEKVTPEYNENIPEN
SNSDNKREATTPTIETPISCKPSLFRLDTNLEDVTDITKTVPPTAVNSTLNSTHGTETAS
PKTVIMPEGPRKSVSMADLSVAAAAPNGEFTSTSNDRSQWVAPQSWDVETKRKKTKPKGR
SKSRRSSIDADELDPMSPGPPSKKDSRHHHDRKDNESMVTAGDSNSSFVDICKENVPNDS
KTALDTKSVNRLKSNLAMSPPSIRYAPSNLDGDYDTSSTSSSLPSSSISSEDTSSCSDSS
SYTNAYMEANREQDNKTPILNKTKSYTKKFTSSSVNMNSPDGAQSSGLLLQDEKDDEVEC
QLEHYYKDFSDLDPKRHYAIRIFNTDDTFTTLSCTPATTVEEIIPALKRKFNITAQGNFQ
ISLKVGKLSKILRPTSKPILIERKLLLLNGYRKSDPLHIMGIEDLSFVFKFLFHPVTPSH
FTPEQEQRIMRSEFVHVDLRNMDLTTPPIIFYQHTSEIESLDVSNNANIFLPLEFIESSI
KLLSLRMVNIRASKFPSNITKAYKLVSLELQRNFIRKVPNSIMKLSNLTILNLQCNELES
LPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKM
NLSHNKLNFIGDLSEMTDLRTLNLRYNRISSIKTNASNLQNLFLTDNRISNFEDTLPKLR
ALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLP
QEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDFVDGMENLELTSLNIS
SNAFGNSSLENSFYHNMSYGSKLSKSLMFFIAADNQFDDAMWPLFNCFVNLKVLNLSYNN
FSDVSHMKLESITELYLSGNKLTTLSGDTVLKWSSLKTLMLNSNQMLSLPAELSNLSQLS
VFDVGANQLKYNISNYHYDWNWRNNKELKYLNFSGNRRFEIKSFISHDIDADLSDLTVLP
QLKVLGLMDVTLNTTKVPDENVNFRLRTTASIINGMRYGVADTLGQRDYVSSRDVTFERF
RGNDDECLLCLHDSKNQNADYGHNISRIVRDIYDKILIRQLERYGDETDDNIKTALRFSF
LQLNKEINGMLNSVDNGADVANLSYADLLSGACSTVIYIRGKKLFAANLGDCMAILSKNN
GDYQTLTKQHLPTKREEYERIRISGGYVNNGKLDGVVDVSRAVGFFDLLPHIHASPDISV
VTLTKADEMLIVATHKLWEYMDVDTVCDIARENSTDPLRAAAELKDHAMAYGCTENITIL
CLALYENIQQQNRFTLNKNSLMTRRSTFEDTTLRRLQPEISPPTGNLAMVFTDIKSSTFL
WELFPNAMRTAIKTHNDIMRRQLRIYGGYEVKTEGDAFMVAFPTPTSGLTWCLSVQLKLL
DAQWPEEITSVQDGCQVTDRNGNIIYQGLSVRMGIHWGCPVPELDLVTQRMDYLGPMVNK
AARVQGVADGGQIAMSSDFYSEFNKIMKYHERVVKGKESLKEVYGEEIIGEVLEREIAML
ESIGWAFFDFGEHKLKGLETKELVTIAYPKILASRHEFASEDEQSKLINETMLFRLRVIS
NRLESIMSALSGGFIELDSRTEGSYIKFNPKVENGIMQSISEKDALLFFDHVITRIESSV
ALLHLRQQRCSGLEICRNDKTSARSNIFNVVDELLQMVKNAKDLST
NT seq 6081 nt   +upstreamnt  +downstreamnt
atgtcatcaaaacctgatactggttcggaaatttctggccctcagcgacaggaagaacaa
gaacaacagatagagcagagctcacctacggaagcaaacgatagaagcattcatgatgag
gtaccaaaagtcaagaagcgtcacgaacaaaatagtggtcacaaatcaagaaggaatagc
gcatatagttattacagcccacggtcgctttctatgaccaaaagcagggagagtatcact
ccaaatggtatggatgatgtaagtatttcgaacgtggaacatccaaggccgacagaaccg
aaaatcaaaaggggtccatatttactgaagaaaacattgagcagtctttcaatgacgagc
gcgaatagtactcatgatgataataaagaccacggttacgctttgaattcatccaagacg
cacaactacacatctactcataaccatcatgacggtcatcatgatcatcatcatgttcag
ttttttcccaataggaagccatcattagcggaaaccctattcaaaaggttttcagggtca
aacagtcacgatggcaataagtcaggaaaggaaagtaaagttgctaacctttccctttca
acggtaaatcctgcacctgctaataggaaaccttctaaagactccactttatctaatcac
ttggctgataacgtgccaagcactttacgaaggaaagtgtcctcattggtacgtggttct
tccgtccatgatataaataatggtattgcagataaacagattagaccaaaggctgttgcg
caatcagaaaatacattacattcatccgatgttcccaatagcaaacgctcgcacagaaaa
agctttctgctaggctccacatcttcttcaagcagtagaagaggttcaaatgtcagttca
atgactaacagtgacagtgcaagtatggcgacgtcgggtagtcatgttctccaacataac
gtatctaatgtttctccaactactaaaagtaaggacagcgttaacagcgaatccgccgat
cacactaataataaatccgagaaagtgactccagaatataatgagaacattccggaaaat
tctaactctgacaacaaacgcgaagccacaacgcctactatagaaacacccatttcatgt
aaaccatcccttttcaggctagatacaaaccttgaggatgttactgatattacaaagacg
gtgccacccaccgctgtcaattctacactaaattctacacacgggactgagactgcctca
cccaaaacggtgatcatgcctgaaggtcctaggaagtcggtgtcaatggctgatctctcc
gtcgctgccgcagcacctaatggtgaattcacatcaacttccaatgatagatcacaatgg
gtagcacctcaaagctgggatgtggaaaccaaaaggaaaaaaacaaaacctaaagggaga
tcgaaatcaagaaggtcaagtatagatgctgatgaacttgatcccatgtcaccggggcca
ccttcaaaaaaagactctcgtcatcatcacgatcgaaaggataacgaatcaatggtcact
gcgggtgacagtaactcaagttttgttgatatatgtaaagaaaacgttccgaatgatagc
aagaccgcactcgatactaaatctgtgaaccgcttaaaaagtaatttggctatgagtccc
ccaagtatacgatatgctccatcaaatttagatggggactacgacacgtcttccacttcc
tcatctttaccgtcctcatctattagttcagaagatacatcttcctgcagcgattcctct
tcgtacactaacgcgtatatggaggccaaccgagagcaggataataaaacaccgatcctg
aataaaacgaaatcgtataccaagaaatttacatcctcttcggtaaatatgaattcacca
gatggtgcccagagttctggattattactacaagatgagaaggacgatgaggtcgagtgc
caactggaacattactataaagatttcagtgatttagatccaaagaggcactatgctatt
cgtatattcaatactgatgacacttttacgactctctcatgtactccagcgactaccgtc
gaagagataatacctgcacttaaaagaaaatttaacattacagcgcaagggaattttcaa
atttccctgaaggtgggaaagttgtcaaaaattttgagaccaacttcgaaacctatttta
attgaaagaaaacttttacttttgaatggttatcgaaagtcagacccacttcatattatg
ggtatagaggatttaagttttgtttttaagtttcttttccatcctgtcacaccttctcac
tttactcctgaacaagaacaaagaataatgagaagcgaatttgttcacgtagatttaagg
aatatggatctgactacacctcccatcattttttaccagcatacgtcagaaatagaaagt
ttagacgtttctaataacgcaaatatattcctacctctggagttcattgaaagctcgatt
aaattattaagtttgagaatggttaatattagagcatctaaatttccttccaatatcact
aaggcgtataaactagtatctttggaattacagagaaacttcataagaaaagtaccgaac
tcaatcatgaaactgagtaatttaacgatattaaaccttcaatgtaatgagcttgaaagc
ctaccggctggatttgttgaactgaaaaatctgcaattgctagacttgtcttcaaacaag
ttcatgcactacccagaagttattaactactgcaccaatcttttacaaatagacctatca
tataataaaatccaaagcttaccacagtccactaagtacctagtaaagcttgcgaagatg
aacctttctcataacaaactaaattttataggcgacttatcggaaatgacagatttgagg
acgctgaacctaagatataacagaatatcatcaattaagacaaatgcgtctaacttgcag
aacctttttttaacagataatagaatttcgaactttgaagacactttgccgaaactaaga
gcccttgaaattcaagagaatccaatcacttctatatccttcaaagatttttatccaaaa
aacatgacaagtttgacgttgaacaaggcacagttatcgagtattcctggagaattactc
accaaactatctttcctcgagaaacttgaacttaatcagaataatttgactagactgcca
caggagatatccaagttgactaaattagttttcctttcagtggcgagaaacaaactagag
tatattccacccgagctatctcaactgaaaagtttgaggacattagatctacattctaac
aacataagggactttgttgacggtatggaaaaccttgaactaacatcgctaaatatttca
tcgaatgcattcggtaactctagcttagaaaattctttttaccataacatgtcatatggg
tcaaagttatctaaaagcctgatgttttttattgctgcagacaatcaatttgatgatgct
atgtggcctcttttcaattgctttgtcaatctgaaagtgctaaatctttcttacaacaat
ttttcagatgtatcgcacatgaaacttgagagcattaccgaattgtacctctccggtaat
aagctcacgacattgtcgggtgatacagttttgaaatggagctctttaaagactttaatg
ttgaatagtaaccaaatgttatctctgcctgcagaattatcaaatctctcacagctaagt
gtatttgatgttggagcaaatcaattaaagtataatatatcaaactatcattacgattgg
aactggaggaataataaagaactaaaatatttgaatttttcaggaaatcgaaggtttgaa
ataaagtcatttataagtcacgatattgatgctgatttgtcagatctgacagtattacct
cagttaaaggtactaggtttaatggacgtaactttaaatactaccaaagtaccggatgaa
aatgtcaatttccgtttaaggacaactgcatcaataataaatgggatgcgctacggtgtt
gctgatacattaggtcaaagagactatgtgtcatctcgtgatgttacctttgaaagattc
cgcggaaatgacgacgaatgcttactatgtcttcatgatagtaaaaaccaaaatgcagat
tatggccacaatatatcaagaattgttagagatatttacgataaaatactgatcagacaa
ctggaaaggtatggagacgaaacagatgataatataaaaactgcacttcgtttcagtttt
ttgcaactgaataaggagattaacggaatgctaaattctgttgataatggtgccgatgtt
gccaatctttcatatgcagacttgctaagtggcgcttgctctactgtgatatatatcaga
gggaagaaactcttcgctgcaaatttaggtgactgtatggctattttatccaaaaacaat
ggtgactaccaaacgctaaccaaacaacatctcccaacaaagcgggaagaatacgagagg
atcagaatatctggcgggtatgtcaacaatggaaaattagatggtgttgtagatgtgtct
agagcagtgggtttttttgatttgcttccccacattcatgcttctcccgacatatctgtc
gtgacattaacaaaagcagacgagatgcttattgtagcaacgcataagttatgggaatac
atggacgtggatacagtttgtgatatcgcgcgtgagaatagtactgatccactccgtgcc
gcagctgagttgaaggatcatgccatggcttacggctgtacagagaatattacaattttg
tgccttgctctttacgagaacattcagcaacaaaatcggttcactttaaataaaaactct
ttaatgactagaagaagtactttcgaggatactacattaagaagacttcaacctgagatt
tctccgccaacaggtaacctagcaatggtcttcactgatatcaaaagctcaaccttctta
tgggagctattccctaacgcaatgaggaccgcaataaaaactcacaatgacattatgcgt
cgtcaactacgaatttacggtggttacgaagtaaagacagaaggagacgcctttatggtg
gcatttcctacgccaactagtggtctgacatggtgcttaagtgttcaattaaaactcttg
gatgcacaatggccggaggaaattacctcagttcaagacggctgccaagttacggataga
aatggtaacattatctatcaaggcctatcagttagaatgggtattcattggggctgccca
gttccagagcttgatttagtgactcaaagaatggactatttggggccgatggtcaataag
gcagcaagggtccagggcgtcgctgacggtggtcagattgcaatgagtagtgatttttac
tctgaattcaacaagataatgaagtatcatgagcgagtagtgaagggcaaggaatctctc
aaggaagtttatggtgaagaaattatcggagaggttcttgaaagagaaattgccatgctg
gaaagtattggttgggcattttttgactttggcgagcataagctaaagggactcgaaacc
aaagaactcgttactattgcgtatcctaagattcttgcttccagacacgaatttgcatct
gaagatgagcagtcaaaattaatcaatgaaacgatgttgtttcgtttaagagtcatttca
aacagactggaatctataatgtcagctttaagcggcggatttattgaactagactctcgg
acggagggaagttatattaaatttaaccctaaagttgaaaatggtattatgcaatcgatt
tctgagaaggatgcgttgttattttttgatcatgtaattactagaatcgaatccagtgtg
gcattattacatttacgacaacagaggtgttcaggactggaaatttgcagaaacgataaa
acatctgctcgaagcaatattttcaatgttgttgacgaacttttacaaatggttaagaac
gcaaaggatttatcaacttga

DBGET integrated database retrieval system