KEGG   Saccharomyces cerevisiae (budding yeast): YJR094C
Entry
YJR094C           CDS       T00005                                 

Gene name
IME1
Definition
(RefSeq) transcription factor IME1
  KO
K12764  meiosis-inducing protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJR094C (IME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YJR094C (IME1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Other transcription factors
   Others
    YJR094C (IME1)
SSDB
Other DBs
NCBI-GeneID: 853556
NCBI-ProteinID: NP_012627
SGD: S000003854
UniProt: P21190
LinkDB
Position
X:complement(604569..605651)
AA seq 360 aa
MQADMHGKLHAALEDGFFLFPFEQQQQPNIYYDTTTDQEDRPCFSFGSTISPRSWHFEKS
DKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERG
KKSSESTRSSSLSSLFSNDESASTFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQ
KDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTD
NIHSFNNRHYSNHKSTNCNYYNNTSNNNNASDNVYEADPFIDEPQVPSYYYPLEIAFDVE
KSPPPSLQKLNSKELEFLKKLNSKLSRYAAAYSFSSSNDQDYYDKVRFQEISYKFSKTYS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcaagcggatatgcatggaaaacttcacgctgccttagaagatggtttcttcctcttt
ccttttgaacagcaacaacaacctaacatttattatgacacaaccaccgatcaagaagac
cgtccttgtttttcttttggatctacaatttcccctagaagttggcattttgaaaagtct
gacaaaattgcctcatctcagctgcagaacttggttcatacacaaccaattcatttaatt
aatcctcaaatattgttcaatgaagagtttctgaatttggaaaatattgattctcagcct
atttccaaggaaacgaaaactacgaaggactgcacaatggcaactggtcctgaaagagga
aaaaagagctctgaaagtaccagatcctcttcattatcatctcttttttctaatgatgaa
tccgcatctacgttccactcatcattcaataaccatgataactttcaaaagagcaacaga
aatggagatgatatcgatattagtgacacaataaaatatgaaactaatacaaatgcacaa
aaagatatcaaaatattccaagaaaattttgaattcaatgaattcccatacacacaagac
ttctacccatataccactaattatacctattcaaaacccacaaatattcatgaatcaata
aattcaaaaaacacggattcatactcccaatatcaagatcagtttccaccacatactgat
aacatacattcctttaataatcgtcactatagcaaccataaaagcactaattgtaattac
tataataataccagcaataataacaacgcctccgataatgtatatgaggcagatccattt
atagatgaacctcaggtgccctcctactattacccattagaaattgccttcgacgttgaa
aaatcaccaccgccatcactacaaaaattaaattcaaaagagttagaattcctaaaaaag
ttgaactccaaactgtcaagatatgctgcggcttactccttcagcagttctaatgatcaa
gattattatgacaaggtcaggtttcaagaaatatcctacaagtttagtaaaacctattct
taa

DBGET integrated database retrieval system