KEGG   Saccharomyces cerevisiae (budding yeast): YLR103C
Entry
YLR103C           CDS       T00005                                 

Gene name
CDC45, SLD4
Definition
(RefSeq) DNA replication initiation factor CDC45
  KO
K06628  cell division control protein 45
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR103C (CDC45)
   04113 Meiosis - yeast
    YLR103C (CDC45)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YLR103C (CDC45)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    YLR103C (CDC45)
SSDB
Motif
Pfam: CDC45 MGDG_synth
Other DBs
NCBI-GeneID: 850793
NCBI-ProteinID: NP_013204
SGD: S000004093
UniProt: Q08032
LinkDB
Structure
PDB: 

Position
XII:complement(343989..345941)
AA seq 650 aa
MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVP
IFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDI
YVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDEND
NNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEY
YSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVK
RLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLH
KMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSIS
ASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLS
WDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYR
NPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKP
ILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgtattatggaatcagccagtttagcgaagcctacaacaaaatcttaaggaattcatcg
tctcattcatcatgtcaattggtcattttcgtttcttgtcttaacatcgatgcgctgtgt
gcgacgaagatgttgtcactattattcaaaaaacaattggtacaatctcaaatagtaccg
atatttgggtactctgaattacgacgccactattctcaattggatgacaatataaatagt
ctgctattagtagggtttggaggcgttattgatctggaggctttcttagaaatcgatccc
caagagtatgttatcgatacagatgaaaagtcgggggaacaaagtttcaggagagacatc
tacgtgttggatgctcatagaccgtggaatctcgacaatatatttggatcacaaatcatc
caatgttttgacgacggtacggtggatgacacattaggcgaacaaaaagaagcatactat
aaattgcttgaactggacgaggagagtggtgacgatgagctctcaggtgacgagaacgat
aataatgggggtgacgatgaggcaactgatgccgatgaagtcacagacgaggacgaagaa
gacgaagatgagacaatatctaataaaagaggtaattcttcaataggaccgaatgatctc
tcaaaaagaaagcaacgaaagaagcaaatccatgaatatgaaggtgttttggaggaatac
tattctcaaggcacaacagtggttaactcgatatctgcacaaatctattcattattgtct
gctatcggagaaacaaatctttcaaacctgtggttgaatatacttggtacgacctcgtta
gatatagcatatgctcaagtttacaatcgattataccccttattgcaagatgaagtgaag
cgtctcacaccaagcagtagaaactcagtaaagacccctgatacattgacgttaaacatc
caaccggattactaccttttcttactgaggcattcttcattgtacgacagtttttattat
tctaactatgtcaatgccaaactatccctatggaatgaaaatgggaaaaagagattgcat
aagatgtttgctagaatgggtataccattaagtactgcacaagaaacatggttatacatg
gatcattctattaagagagaacttgggataatatttgacaaaaatttggatcgttatggg
ttgcaagatataattagagatgggtttgttagaactcttggatatcgtgggtccataagt
gccagtgaatttgtcgaagcactaacagctcttttggaagtaggtaattcaactgataag
gatagtgtgaaaataaataatgacaataatgacgatacagatggagaggaagaagaagat
aacagcgctcaaaaattgacgaatttgagaaaaagatgggtttcgaatttttggctcagt
tgggatgctctagatgacagaaaggtggaactattaaaccgtggcattcaactagcacaa
gacttacagagagcaatttttaataccggggttgctatattggagaagaaattaatcaag
catttaagaatttatagattatgcgtcttacaagacggacccgatttagacttgtacaga
aacccattgacgttattaagattaggaaattggctcatagaatgctgtgcggaatctgaa
gacaagcaattgttgcccatggtgcttgccagcatagatgaaaatacggacacttacttg
gttgctgggttaacacctaggtatcctcgcggactagacacgatacacacaaaaaaacct
attttgaataatttcagcatggcgtttcaacaaataactgcagaaacggatgctaaagtg
agaatagataattttgaaagttccataattgaaatacgtcgtgaagatctttcaccattc
ctggagaagctgaccttgagtggattgttataa

DBGET integrated database retrieval system