KEGG   Saccharomyces cerevisiae (budding yeast): YLR274W
Entry
YLR274W           CDS       T00005                                 

Gene name
MCM5, BOB1, CDC46
Definition
(RefSeq) MCM DNA helicase complex subunit MCM5
  KO
K02209  DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YLR274W (MCM5)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR274W (MCM5)
   04113 Meiosis - yeast
    YLR274W (MCM5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YLR274W (MCM5)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR274W (MCM5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YLR274W (MCM5)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YLR274W (MCM5)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YLR274W (MCM5)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N AAA_5 Mg_chelatase AAA_3 DUF1822 AAA
Other DBs
NCBI-GeneID: 850980
NCBI-ProteinID: NP_013376
SGD: S000004264
UniProt: P29496
LinkDB
Structure
PDB: 

Position
XII:691555..693882
AA seq 775 aa
MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYS
LTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENT
SMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLS
IMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDP
YIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSI
YNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQL
SRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGT
AKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCID
EFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNI
DFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMK
RYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRIT
ESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKR
RLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgtcatttgatagaccggaaatatacagtgctcctgttttacaaggagaatctcctaac
gacgatgataatactgaaatcataaagtcctttaagaatttcattttggagttcagactt
gactcgcaatttatttacagagatcagttaaggaacaacatccttgtgaagaattattct
ttaacggttaacatggagcatttgatcggatataacgaagacatatataagaaactatca
gacgaaccttcagatatcattccattattcgaaaccgcgatcacacaagtggctaaaagg
ataagtattctaagcagagctcaatctgctaataacaatgacaaagatccagaaaatact
agtatggatactgattctctcttattgaactctttaccaacatttcaattaattttaaac
tccaatgcaaatcagattccattgagagatttggattctgaacacgtctccaagattgtc
cgtttatcaggtattataatatccacgtcagttttatcttcccgtgccacgtacctttct
ataatgtgcagaaattgcagacacacaacatcaataacaatcaacaatttcaattctatc
acaggcaataccgtcagtttaccacgttcttgcttatctacgattgagagtgaatcttct
atggcaaacgagtcgaatattggtgatgaatcgaccaagaaaaattgtggacctgatcca
tatattattatccatgagtcttcaaagtttattgatcaacagtttttaaaattacaggaa
atcccagaactggttccagtaggtgagatgcctagaaacttaacaatgacttgtgaccga
tacctaacaaacaaagttattcctggtacgagagtcactatagtaggtatttattccatc
tataattctaaaaatggtgccggatccggaaggagcgggggtggaaatggaggaagtggt
gttgctattagaacaccttatatcaaaatattaggtattcagtccgatgtagaaacctcc
tctatttggaattcagtaactatgtttactgaggaggaagaagaggaatttctacagcta
agtagaaacccgaagctttatgaaattttgaccaactctattgccccctctatttttggt
aatgaagatataaaaaaagccattgtatgtttattgatgggtggttccaagaagatatta
cccgatggtatgaggttaagaggtgatatcaatgtactattattaggtgatccaggtacc
gccaaatctcaactattgaaatttgtggagaaagtgtcacctattgcggtatatacatct
ggtaagggatcttctgcagctgggttaactgccagtgtacaaagagatccgatgacaaga
gaattttatttggaaggtggtgctatggtgcttgccgatggtggtgttgtatgcatcgat
gaattcgataaaatgagagatgaagatagagtggccattcatgaagctatggagcagcaa
acaatctccatcgcaaaagctggtatcactacagtgctaaattctagaactagtgtttta
gcggctgctaatccgatatacggccggtatgatgatttgaagtctcctggtgacaacatt
gatttccaaactactattttatcccgttttgatatgatttttattgttaaggatgaccat
aatgaagaacgtgatatttcaatagctaaccacgttattaatattcatacaggaaatgct
aatgctatgcaaaaccaacaagaggaaaatggcagtgaaattagtattgaaaagatgaaa
cgttacattacgtattgtagattgaaatgtgcaccaagactttcaccgcaggccgctgaa
aaactgtcatcgaacttcgtcaccattaggaagcaattattaatcaacgaattagagtca
acggaaaggtcgtctattccaattaccattcgtcaattagaagctattattagaataaca
gaatcattagccaagttagaattaagtcctattgcacaggagagacatgttgacgaagct
attagattgtttcaagcttccacaatggacgcagcgtctcaggatccaattggcggctta
aatcaagcaagcggaacatctttgtcagaaatccgtcgttttgaacaagaactaaaaaga
agattacctataggctggtctacttcttatcaaactttgaggagagaatttgtagataca
catagattttctcaattagcactggataaggccttatatgccctagagaagcatgaaaca
attcaattgagacaccagggacagaatatttacagaagtggtgtatga

DBGET integrated database retrieval system