KEGG   Saccharomyces cerevisiae (budding yeast): YMR139W
Entry
YMR139W           CDS       T00005                                 

Gene name
RIM11, GSK3, MDS1
Definition
(RefSeq) serine/threonine protein kinase RIM11
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YMR139W (RIM11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YMR139W (RIM11)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YMR139W (RIM11)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   YMR139W (RIM11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase WHIM1 FAS_meander
Other DBs
NCBI-GeneID: 855170
NCBI-ProteinID: NP_013859
SGD: S000004747
UniProt: P38615
LinkDB
Position
XIII:546125..547237
AA seq 370 aa
MNIQSNNSPNLSNNIVSKQVYYAHPPPTIDPNDPVQISFPTTEVVGHGSFGVVFATVIQE
TNEKVAIKKVLQDKRFKNRELEIMKMLSHINIIDLKYFFYERDSQDEIYLNLILEYMPQS
LYQRLRHFVHQRTPMSRLEIKYYMFQLFKSLNYLHHFANVCHRDIKPQNLLVDPETWSLK
LCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMF
PGESGIDQLVEIIKILGTPSKQEICSMNPNYMEHKFPQIKPIPLSRVFKKEDDQTVEFLA
DVLKYDPLERFNALQCLCSPYFDELKLDDGKINQITTDLKLLEFDENVELGHLSPDELSS
VKKKLYPKSK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaatattcaaagcaataattctccgaatctcagtaataacatagtgtcaaaacaggtt
tactacgcccatcctccacctacgatagacccgaatgatccggtgcagatatctttccct
accaccgaagtagttgggcatggttcgtttggtgtggtatttgccactgttattcaagaa
actaatgaaaaagttgctattaagaaagtcctgcaagataaacgattcaagaacagagag
ctggaaataatgaaaatgctgagtcacataaatataatagatctgaagtactttttctat
gaaagggactcccaagatgagatttatttaaatttgatactagaatacatgccacaatct
ttgtaccagaggttacgtcatttcgtccatcaacgtacgccgatgtcaagattggaaata
aagtactacatgtttcaattgttcaagtcattgaattacctccatcatttcgcgaacgtc
tgtcatagagacattaagcctcaaaatttattagtagatcctgagacctggtccttaaaa
ctgtgcgatttcggcagtgcaaagcaattgaaacctactgaacctaacgtttcctatatt
tgttcacggtactatagagcaccagagctaatcttcggcgcaacaaattataccaaccaa
atcgacatatggtcctctggctgcgtaatggcggaactgctattgggccaaccaatgttc
cctggagaaagtggtattgatcaactagtggaaatcattaaaatcttaggtactccatca
aagcaagaaatttgctctatgaatcccaattatatggagcataagttcccgcaaattaaa
ccaataccattgtcacgtgttttcaagaaagaagatgatcaaactgtggaatttctagct
gacgttttgaaatatgatccactagaaagatttaatgctctacaatgcctgtgtagtcca
tattttgatgaactaaaacttgatgacggtaaaataaatcaaataacaactgatttaaaa
ttgctagagttcgatgaaaatgtcgaattgggccatctatctcccgatgaactatcatct
gtaaaaaaaaagctatatccgaagtctaagtaa

DBGET integrated database retrieval system