KEGG   Saccharomyces cerevisiae (budding yeast): YMR314W
Entry
YMR314W           CDS       T00005                                 
Symbol
PRE5
Name
(RefSeq) proteasome core particle subunit alpha 6
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    YMR314W (PRE5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YMR314W (PRE5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YMR314W (PRE5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YMR314W (PRE5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     YMR314W (PRE5)
Peptidases and inhibitors [BR:sce01002]
 Threonine peptidases
  Family T1: proteasome family
   YMR314W (PRE5)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    YMR314W (PRE5)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YMR314W (PRE5)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 855362
NCBI-ProteinID: NP_014045
SGD: S000004931
UniProt: P40302
Structure
LinkDB
Position
XIII:901709..902413
AA seq 234 aa
MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQ
KKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNT
QSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFI
KIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI
NT seq 705 nt   +upstreamnt  +downstreamnt
atgttcaggaacaattacgacggggacacagtcactttttctcctacaggccgtctgttc
caagtggaatacgccttggaagctattaaacaagggagcgtcactgtggggttacgttcg
aacactcatgctgttttagtagcgttgaaaagaaatgcagacgaattgtcatcataccag
aaaaaaatcatcaaatgtgacgagcacatggggctctcgttagccgggttggctccagat
gctagagttttaagtaattatttgagacaacagtgtaattactccagcttagtttttaac
agaaagcttgccgtcgagagagcaggtcatttgctttgcgataaagcacagaaaaataca
caatcctatgggggcagaccctacggtgttggtttgttgatcatcgggtatgacaagagc
ggtgctcatcttttagaattccaaccttccggaaatgtcacagaactatatggtacagct
attggcgcaagaagccaaggggcaaagacttatctagagagaactttagacacgtttata
aaaattgacgggaacccggatgaactaatcaaagctggcgtcgaggctatcagccagtct
ctaagggacgaatccttgactgtagacaatctttcaatcgccatcgtgggtaaggatacg
ccttttacaatttacgatggagaagctgttgctaaatacatctag

DBGET integrated database retrieval system