KEGG   Saccharomyces cerevisiae (budding yeast): YNR037C
Entry
YNR037C           CDS       T00005                                 
Symbol
RSM19, uS19m
Name
(RefSeq) mitochondrial 37S ribosomal protein RSM19
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Ribosomal_S19
Other DBs
NCBI-GeneID: 855773
NCBI-ProteinID: NP_014435
SGD: S000005320
UniProt: P53733
Structure
LinkDB
Position
XIV:complement(695052..695327)
AA seq 91 aa
MQPAARLLSRSVWKGPNIVPLPIREAMTKGTPIRTNARAATILPQFVGLKFQIHNGKEYV
PIEISEDMVGHKLGEFAPTRKRFSYTQTKNK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgcaaccggcagctagacttttatcgcggtccgtatggaagggccccaacatcgtgcca
ttacccataagggaggccatgactaagggcactccaataagaacaaacgcaagggccgcc
accatccttcctcagttcgtgggactgaaatttcaaatacacaatggtaaggagtacgta
cctattgaaatatcagaagatatggtgggccacaaactgggcgagttcgcacctaccagg
aagcgtttcagctatactcaaaccaagaacaaatga

DBGET integrated database retrieval system