KEGG   Saccharomyces cerevisiae (budding yeast): YOR317W
Entry
YOR317W           CDS       T00005                                 

Symbol
FAA1
Name
(RefSeq) long-chain fatty acid-CoA ligase FAA1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00061  Fatty acid biosynthesis
sce00071  Fatty acid degradation
sce01100  Metabolic pathways
sce01212  Fatty acid metabolism
sce04146  Peroxisome
Module
sce_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YOR317W (FAA1)
   00071 Fatty acid degradation
    YOR317W (FAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YOR317W (FAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YOR317W (FAA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YOR317W (FAA1)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     YOR317W (FAA1)
Lipid biosynthesis proteins [BR:sce01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   YOR317W (FAA1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   YOR317W (FAA1)
  Exosomal proteins of breast cancer cells
   YOR317W (FAA1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 854495
NCBI-ProteinID: NP_014962
SGD: S000005844
UniProt: P30624
LinkDB
Position
XV:909343..911445
AA seq 700 aa
MVAQYTVPVGKAANEHETAPRRNYQCREKPLVRPPNTKCSTVYEFVLECFQKNKNSNAMG
WRDVKEIHEESKSVMKKVDGKETSVEKKWMYYELSHYHYNSFDQLTDIMHEIGRGLVKIG
LKPNDDDKLHLYAATSHKWMKMFLGAQSQGIPVVTAYDTLGEKGLIHSLVQTGSKAIFTD
NSLLPSLIKPVQAAQDVKYIIHFDSISSEDRRQSGKIYQSAHDAINRIKEVRPDIKTFSF
DDILKLGKESCNEIDVHPPGKDDLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLK
FVGNTDRVICFLPLAHIFELVFELLSFYWGACIGYATVKTLTSSSVRNCQGDLQEFKPTI
MVGVAAVWETVRKGILNQIDNLPFLTKKIFWTAYNTKLNMQRLHIPGGGALGNLVFKKIR
TATGGQLRYLLNGGSPISRDAQEFITNLICPMLIGYGLTETCASTTILDPANFELGVAGD
LTGCVTVKLVDVEELGYFAKNNQGEVWITGANVTPEYYKNEEETSQALTSDGWFKTGDIG
EWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSNEYVANICVYADQSKTKPVGIIV
PNHAPLTKLAKKLGIMEQKDSSINIENYLEDAKLIKAVYSDLLKTGKDQGLVGIELLAGI
VFFDGEWTPQNGFVTSAQKLKRKDILNAVKDKVDAVYSSS
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggttgctcaatataccgttccagttgggaaagccgccaatgagcatgaaactgctcca
agaagaaattatcaatgccgcgagaagccgctcgtcagaccgcctaacacaaagtgttcc
actgtttatgagtttgttctagagtgctttcagaagaacaaaaattcaaatgctatgggt
tggagggatgttaaggaaattcatgaagaatccaaatcggttatgaaaaaagttgatggc
aaggagacttcagtggaaaagaaatggatgtattatgaactatcgcattatcattataat
tcatttgaccaattgaccgatatcatgcatgaaattggtcgtgggttggtgaaaatagga
ttaaagcctaatgatgatgacaaattacatctttacgcagccacttctcacaagtggatg
aagatgttcttaggagcgcagtctcaaggtattcctgtcgtcactgcctacgatactttg
ggagagaaagggctaattcattctttggtgcaaacggggtctaaggccatttttaccgat
aactctttattaccatccttgatcaaaccagtgcaagccgctcaagacgtaaaatacata
attcatttcgattccatcagttctgaggacaggaggcaaagtggtaagatctatcaatct
gctcatgatgccatcaacagaattaaagaagttagacctgatatcaagacctttagcttt
gacgacatcttgaagctaggtaaagaatcctgtaacgaaatcgatgttcatccacctggc
aaggatgatctttgttgcatcatgtatacgtctggttctacaggtgagccaaagggtgtt
gtcttgaaacattcaaatgttgtcgcaggtgttggtggtgcaagtttgaatgttttgaag
tttgtgggcaataccgaccgtgttatctgttttttgccactagctcatatttttgaattg
gttttcgaactattgtccttttattggggggcctgcattggttatgccaccgtaaaaact
ttaactagcagctctgtgagaaattgtcaaggtgatttgcaagaattcaagcccacaatc
atggttggtgtcgccgctgtttgggaaacagtgagaaaagggatcttaaaccaaattgat
aatttgcccttcctcaccaagaaaatcttctggaccgcgtataataccaagttgaacatg
caacgtctccacatccctggtggcggcgccttaggaaacttggttttcaaaaaaatcaga
actgccacaggtggccaattaagatatttgttaaacggtggttctccaatcagtcgggat
gctcaggaattcatcacaaatttaatctgccctatgcttattggttacggtttaaccgag
acatgcgctagtaccaccatcttggatcctgctaattttgaactcggcgtcgctggtgac
ctaacaggttgtgttaccgtcaaactagttgatgttgaagaattaggttattttgctaaa
aacaaccaaggtgaagtttggatcacaggtgccaatgtcacgcctgaatattataagaat
gaggaagaaacttctcaagctttaacaagcgatggttggttcaagaccggtgacatcggt
gaatgggaagcaaatggccatttgaaaataattgacaggaagaaaaacttggtcaaaaca
atgaacggtgaatatatcgcactcgagaaattagagtccgtttacagatctaacgaatat
gttgctaacatttgtgtttatgccgaccaatctaagactaagccagttggtattattgta
ccaaatcatgctccattaacgaagcttgctaaaaagttgggaattatggaacaaaaagac
agttcaattaatatcgaaaattatttggaggatgcaaaattgattaaagctgtttattct
gatcttttgaagacaggtaaagaccaaggtttggttggcattgaattactagcaggcata
gtgttctttgacggcgaatggactccacaaaacggttttgttacgtccgctcagaaattg
aaaagaaaagacattttgaatgctgtcaaagataaagttgacgccgtttatagttcgtct
taa

DBGET integrated database retrieval system