KEGG   Saccharomyces cerevisiae (budding yeast): YOR368W
Entry
YOR368W           CDS       T00005                                 

Gene name
RAD17
Definition
(RefSeq) Rad17p
  KO
K02830  cell cycle checkpoint protein [EC:3.1.11.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YOR368W (RAD17)
   04113 Meiosis - yeast
    YOR368W (RAD17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOR368W (RAD17)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     YOR368W (RAD17)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    YOR368W (RAD17)
   Rad17-Mec3-Ddc1 complex
    YOR368W (RAD17)
SSDB
Motif
Pfam: Rad1
Other DBs
NCBI-GeneID: 854550
NCBI-ProteinID: NP_015013
SGD: S000005895
UniProt: P48581
LinkDB
Position
XV:1026843..1028048
AA seq 401 aa
MRINSELANKFSASTVHLEHITTALSCLTPFGSKDDVLIFIDADGLSFVRENNHVIKIQL
LLSRELFMSYSYRNETEDHMKLCVKINHILDSVSVMNRNSDDIVECTLSYDGHGSPFVLI
FEDSFISERVEYSTYLIKDFDTNGLELDRERISFEAIIKGEALHSALKDLKEIGCKECYV
YAKTEANDENVFALISKSQLGFSKIKLPSNRSILEKLQVFDGDSTTVIDGFAVIGFFDFT
SFDKIRKSTKIASKVLFRMDVHGVLSVNILSQTDDVIITDTTRPSNNRPGSIRQLQLPKD
YPGIVIEVCMLEKESIDEAAQTEIELLMETNELGNRNSFKKSTIRKRYGTDKGNETSNDN
LLQLNGKKIKLPSEEENNKNRESEDEENHCKYPTKDIPIFF
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcgaatcaacagtgagctagcgaacaagttttctgcctcaacggtgcacttagaacat
atcacaactgctttaagttgtttaacaccttttggttctaaagacgatgtgcttatattc
attgatgctgatgggctgtcatttgtcagggagaataatcatgtgataaaaatccaacta
ctgttatctcgggagctatttatgtcttattcgtatagaaatgaaactgaggatcacatg
aaactttgtgtaaaaataaatcatatcttagatagcgttagcgtgatgaacaggaattcg
gatgacattgttgagtgtactttatcttatgatggacatggatcaccatttgtactaata
tttgaagactcgttcatttctgagagagtggagtactctacctacttaattaaggatttt
gatactaatggactagaactcgatagagaaaggataagctttgaggcaattattaagggc
gaagcccttcattcagccttaaaggatctaaaagaaatcggatgcaaagagtgctatgta
tatgcaaagaccgaggcgaatgatgagaatgtatttgccctgatatctaaatctcagcta
ggattttctaaaataaaattacccagtaacagatccatactagagaagttacaagtattt
gacggagattccacaacagtaatagatggttttgctgtaattgggttcttcgatttcacc
tcgtttgataaaatcagaaagagtactaaaattgcaagcaaagtccttttcaggatggat
gttcatggcgtattgagtgtaaatattctaagtcaaacagacgatgtcattatcactgat
actacaagaccttcaaataatcgaccaggtagtattcgccaactgcagctacccaaggat
tatcccggtatagtaattgaggtttgcatgctagaaaaagaatccatagatgaggcagca
cagacagaaatagaactcctgatggagactaatgaacttggcaatcgtaatagttttaaa
aaatcaactataagaaaaagatatggtacagataaaggcaatgaaacttcaaatgacaac
ttgctgcaattgaatgggaaaaaaattaaactaccatctgaagaagaaaacaataaaaac
agggaaagtgaggatgaagagaatcactgcaagtatccaacaaaggatattcctatattt
ttttaa

DBGET integrated database retrieval system