KEGG   Saccharomyces cerevisiae (budding yeast): YPL194W
Entry
YPL194W           CDS       T00005                                 

Gene name
DDC1
Definition
(RefSeq) Ddc1p
  KO
K06663  DNA damage checkpoint protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YPL194W (DDC1)
   04113 Meiosis - yeast
    YPL194W (DDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YPL194W (DDC1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    YPL194W (DDC1)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 855907
NCBI-ProteinID: NP_015130
SGD: S000006115
UniProt: Q08949
LinkDB
Position
XVI:179277..181115
AA seq 612 aa
MSFKATITESGKQNIWFRAIYVLSTIQDDIKITVTTNELIAWSMNETDTTLCQVRFQKSF
FEEYEFKPHEIVFGENGVQVIEDTYGNSHKLYSFRVNGRHLTTISRKPDGDGIKSFTIAV
NNTSTCPESLANRLIVVIEMDSLIVKEYCPQFQPIKYDPIIINLKYKRRFLDVFGTAASD
RNPQEPLDPKLLDVFTNTERELTSALFNEEVESDIRKRNQLTAADEINYICCNSTLLKNF
LDNCNVNVTDEVKLEINVHRLSITAFTKAVYGKNNDLLRNALSMSNTISTLDLEHYCLFT
TIEDEKQDKRSHSKRREHMKSIIFKLKDFKNFITIGPSWKTTQDGNDNISLWFCHPGDPI
LMQMQKPGVKLELVEVTDSNINDDILEGKFIKTAISGSKEEAGLKDNKESCESPLKSKTA
LKRENLPHSVAGTRNSPLKVSYLTPDNGSTVAKTYRNNTARKLFVEEQSQSTNYEQDKRF
RQASSVHMNMNREQSFDIGTTHEVACPRNESNSLKRSIADICNETEDPTQQSTFAKRADT
TVTWGKALPAADDEVSCSNIDRKGMLKKEKLKHMQGLLNSQNDTSNHKKQDNKEMEDGLG
LTQVEKPRGIFD
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgtcatttaaggcaactatcaccgagtcggggaagcagaatatctggtttcgtgcgata
tatgtgttatctacaattcaggatgatatcaagattacagtgacaacaaatgagttaatt
gcttggtcaatgaacgagacagatactactctttgtcaggttaggtttcagaaaagcttt
tttgaggagtatgagtttaaaccacatgagattgtatttggagaaaatggggttcaagtt
atagaagatacgtacggcaatagtcataagttatactccttccgtgttaatggaagacac
ctaacaactatatcaagaaagccggatggtgatggcatcaaatcattcacaattgcggta
aacaacacttctacctgtcctgaatcacttgcaaatagattgattgtggtgattgaaatg
gattcgttaatagtcaaagaatactgtccccaattccagccaataaaatacgatcccata
ataatcaaccttaagtacaaaaggaggtttttggatgtttttggaactgctgcctccgat
cggaatccacaggagcccttggaccctaagctattggacgtttttacaaatacagagcgt
gagctaacatcagccttatttaacgaagaagtggaatcagacatacgtaaaaggaatcag
ttaacggctgctgatgagattaattacatttgttgtaattcaactttattgaagaatttt
ttagacaactgcaatgttaatgtaaccgatgaagtaaaattggaaattaacgtacatagg
ctaagcataactgcattcaccaaggccgtctacggcaaaaataacgaccttttaagaaat
gcgttaagcatgagtaacactatcagtacgctcgatcttgagcattattgcttatttaca
acaatcgaagatgaaaaacaagataagcgatcacatagtaagcgtagagagcatatgaaa
agtataatattcaaattgaaggacttcaaaaacttcataacgataggtccatcctggaag
actacccaggacggaaatgataatataagtttatggttttgccacccaggggaccctatt
cttatgcaaatgcaaaaaccgggcgtaaaattagaattggttgaagttactgacagtaac
attaacgatgatattttagaaggaaaattcataaaaacagcaatctctggctccaaagaa
gaggccggactgaaagacaacaaagaaagctgcgaaagtccattaaaaagcaaaactgct
ttaaagagagaaaacctgccacactctgtggctggaactcgaaacagtcctttgaaagtg
tcgtatctgacccctgataatggaagcacagttgctaagacctatagaaataacacggca
agaaaattattcgtggaagaacaaagccaaagtacgaattacgaacaagataagcggttc
cggcaggctagttcagttcatatgaacatgaatcgggaacaaagttttgacattggtacg
actcatgaagtggcctgtccacgtaatgagagcaattctttaaaaagatccatagcagat
atttgtaatgaaactgaagaccccacccaacaatctacatttgcaaaaagggcagacacc
actgtgacatggggaaaagcgttaccagctgcagatgatgaggtttcatgcagcaatatc
gatagaaaaggaatgctcaagaaagaaaaattgaagcatatgcaaggtctgttgaattcc
cagaatgacacaagtaatcacaagaaacaggacaataaagagatggaagatgggctgggt
ctaacacaagtagaaaagccaaggggtatatttgactaa

DBGET integrated database retrieval system