KEGG   Streptomyces collinus: B446_20640Help
Entry
B446_20640        CDS       T02787                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sci  Streptomyces collinus
Pathway
sci00250  Alanine, aspartate and glutamate metabolism
sci00410  beta-Alanine metabolism
sci00430  Taurine and hypotaurine metabolism
sci00650  Butanoate metabolism
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
sci01120  Microbial metabolism in diverse environments
sci02024  Quorum sensing
Module
sci_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    B446_20640
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B446_20640
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B446_20640
   00430 Taurine and hypotaurine metabolism
    B446_20640
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    B446_20640
Enzymes [BR:sci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B446_20640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGS70940
UniProt: S5VSK1
LinkDB All DBs
Position
complement(4772210..4773616)
Genome map
AA seq 468 aa AA seqDB search
MALHEGPEKHNERPMSVNPFFGQANPVAEMTQAPPKHRLPDSPLPPDTAAQLVHDELMLD
GNSRLNLATFVTTWMEPQAGDLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
AAAVGCSTTGSSEACMLAGMALKRRWAKRNADRYPGARPNLVMGVNVQVCWEKFCNFWEV
EARLVPMEGDRYHLDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALDALQERTG
LDVPVHVDGASGAMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDGESL
PEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQTTRDVATELAD
RIEALDDFRLLTRGDELPVFAFTTAPGVESYDVFDLSRRLRESGWLVPAYTFPPNREDLS
VVRIVCRNGFSRDLADLFMDDLSRLLPELRRQPHPQTRDKAAATSFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcacgaaggccccgagaagcacaacgagcggccgatgtcggtcaacccgttc
ttcgggcaggcgaacccggtcgccgagatgacccaggccccgcccaagcaccggctgccc
gactcgcccctgccgcccgacacggcggcgcagctcgtgcacgacgagctgatgctggac
ggcaactcccggctgaacctggccaccttcgtcaccacctggatggagccgcaggccggg
gacctgatggcggagtgccgcgacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgaactggagcggcgctgtgtggcgatgctcgccgacctgtggaacgcgcccgacccg
gccgccgccgtgggctgttcgaccacggggtcgagcgaggcgtgcatgctcgccggcatg
gcgctcaagcggcgctgggcgaagcgcaacgcggaccgctacccgggagcccgcccgaac
ctggtcatgggcgtcaacgtccaggtgtgctgggagaagttctgcaacttctgggaggtg
gaggcccggctggtcccgatggagggcgaccgctaccacctggacccgcaggcggcggcc
gagctgtgcgacgagaacaccatcggggtcgtcggcatcctcggctcgaccttcgacggg
tcgtacgagccgatcgcggacctgtgcgcggccctcgacgccctccaggagcgcaccggc
ctcgacgtgcccgtgcacgtggacggcgcgtccggcgcgatggtggcgcccttcctggac
gaggacctggtgtgggacttccggctgccgcgtgtggcgtcgatcaacacctcggggcac
aagtacggcctggtgtacccgggtgtcggctgggcgctgtggcgggacggggagtcgctg
cccgaggagctggtcttccgggtcaactacctgggcggcgacatgcccaccttcgcgctc
aacttctcccgccccggcgcccaggtggtggcgcagtactacacgttccttcggctgggc
cgcgagggctaccgggcggtgcagcagaccacgcgggacgtggcgaccgagctggcggac
cggatcgaggcgctcgacgacttccgcctgctgacccggggcgacgagctgccggtgttc
gccttcacgaccgcgccgggcgtcgagtcgtacgacgtgttcgacctctcccggcggctg
cgcgagagcggctggctggtgcccgcctacaccttcccgccgaaccgggaggacctgtcc
gtggtgcggatcgtgtgccgcaacggcttctcccgcgacctcgccgacctcttcatggac
gacctgtcccgcctgctgcccgagctgcgccggcagccgcacccgcagacccgggacaag
gcggcggcgaccagcttccaccactag

DBGET integrated database retrieval system