KEGG   Streptomyces coelicolor: SCO5892
Entry
SCO5892           CDS       T00085                                 

Gene name
redL, SC3F7.12
Definition
(RefSeq) polyketide synthase
  KO
K21792  polyketide synthase
Organism
sco  Streptomyces coelicolor
Pathway
sco00333  Prodigiosin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SCO5892 (redL)
SSDB
Motif
Pfam: AMP-binding ketoacyl-synt Acyl_transf_1 Aminotran_1_2 Ketoacyl-synt_C PP-binding KAsynt_C_assoc Thiolase_N Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-GeneID: 1101334
Kitasato: SCO5892
UniProt: O54155
LinkDB
Position
6449549..6456442
AA seq 2297 aa
MARNRREKNVSHGPTDPLHEHWQGPEPETVTALLRHRAEHTPDALAHRFLTDTDGTSVAW
TYRELDLHAREVATHLRHAGVGQGPVLLLHPPGLDYLAAFFGCLYAGAVAVPAYPPDNAR
FGQTVPRLAAIARDCAATHALTTRRVRETVAADGTGRVGTELDGVRWLVTEDLYTGESTT
AWEDPGATARSLAFLQYTSGSTAAPKGVMVEHGNLVRNLRSIHLRLGHDADSGMVSWLPP
YHDMGLIGGILTPVYGGFPAHLMAPMTFVQRPLLWLETLSRTGASTSVAPNFGFEQCLRR
ITPAQRAGLDLSRWRLALNGAEPIRPDTLDRFAEYFAPAGFDRTALLPCYGLAEATLMVT
GVRPADPPVVESFDAAALEAGTARPADPGGVRTTRVVGCGAPVADVEVAVVDAATGRRVP
DGTVAEIRVSGPGVARGYWGRPEAAAEVFGTRIDGEPGNAWLRTGDVGFRHDGQLYVVGR
TKDVIIVQGRNIHPQDVEQTAERVGAGLRAGYGAAFAVPTADGEQLALAYEIGGPGAGDP
HALLARLRTAIADEHQVTPHTVVLLKRSSVPRTTSGKIQRGACRQRLLDLELPVVAASVV
QDGALPDTPAPHAPASPDRTAALVADALDRAATDAPDGTSRYPRLLTAVRTLSERLGVAL
DVGELLSGPEPDGAPSLTGLCRAALADAAPAPTAAPERTRTQAVDWLRRAVAARLGLRPS
VIDTAVPFTSLGLDSKQAVALTAPFGDWLGTPVTPATLYDHPTVESLAAHVTGPEADGTP
HPHPRRPAPEPARGRADEPVAVIGIGCRFPGAPDPDSYWRLLRDGRDAVGEAPADRHGDT
GGRPGGFLEHVYDFDARFFGVSARETERMDPQQRLLLEVAWQTFEDAGIAPSSLAGTDTG
VFVGISGHDYADLQMPHPDVVDMYSATGNAQSVAAGRLSYFFDLTGPSLALDTACSSSLA
AVHTALRSLRDGECGVALAGGVNLMLTPGLSEALARGGMLGPGGRCRTFDDGADGYVRGE
GAGLVCLKPLSAALADGDRVHAVLTGSALGHGGRANGLTAPRSTAQRAVMTGALERAGVQ
PGQIDYVEAHGTGTALGDPIEWEALAGVYGRGRPADAPCPVGSVKTAIGHLEAAAGIAGL
IKAVLVVREREVPPLLHLATPNRHLDWTGSGLTVPTTRRALPAGGTLRAGVSSFGFGGTN
AHVIVESAPAPPAPAGESGAPDGTVHALSLSAHTESALATLAGRYRTHLAAHPGVPLAAL
CHSARTGRSRLPHRAVLTAATRDELDTALEALIRREPAVDVARGGPADGTAPTVAFLFGG
QGTQYPGMGRDLYDAHPVLARTLRRADAVLRGLGEIPLLDLLFDPDRAEDLARTRYCQPA
LVALEVALADLWTSCGVRPAAVLGHSVGALAAACVAGVLSLEDALTLAVVRGRAMDEQPG
EGAMIACVGDPETVREIAAGHDRVALAAVNAPRNLVFSGAADRIAALRGDLERKGVTVRP
LAVSHAFHSPLMAGAAEPLLEAARAVEFQPPAIPWISDATGEPVTRVDAEYWVRHLLGTV
RFADGFARLRAGNAEGGLGCDAFVEIGPHPTLLNLGRSAVADGPEPDGRRTLWLPSLRRG
APGRRTLLRSLGGYQCAGGDIDWSALDDEHPPARVPLPHTPFERRTYRFQAPTPDQEGDP
MPSQPTVPGTAPTGPAGEVSRTVLDTVARVCGFPVADLPVHARLGLELGFDSLMRTDLQR
RLTDRFPQRMHTLQDLPEDPTVQDIIGRLAAGDDRDGDPAGGAHTARPALAGTGPAAPPA
HPAAVPAAPPVPAPQYAPYGAFPAPPHGYAVAAPVPQPGVPYPYPYGYPPHGAPGYAYYV
PQPYPPQAFPPPAPPSPLQAAPAPVPAAAPAPVPDPVPAPAAPVRQERAFEDWAEYAELQ
GRLRQTRTSGSNPYGRTHEGFNSALATVDGTKVVNFAAFNYLALSHHPRVRQAAKDAVDR
YGTSASATPLLFGETPLHHELEAEIARFIGTEAAIVFAGGHATNVATVGHLFGPEDLVVH
DAWIHDSTVRGCILSGARRRSFPHNDWAALDRILTGARASHRRALVVIEGAYSQDGDIPD
LPRFIEVKKRHGAMLMIDEAHSIGVLGRTGRGVGEHYGTDPADVDLWMGTLSKALGSLGG
YIAARRPIIEYLKFTAPLHIFSTGISPANAAAALEALRVVQDEPERVARVQELAEFFRAG
ARARGLDVGVSRLSAVIPVITGDWEKTMALSNSLLERGVNVMPIGYPAVPRDQCRLRFFI
NADHSEADLEHSLDLLV
NT seq 6894 nt   +upstreamnt  +downstreamnt
atggcccggaaccgcagggagaagaacgtgagccacgggccgacggacccgctgcacgag
cactggcagggacccgaaccggagacggtcacggccctgctgcggcaccgggcggaacac
acccccgacgccctcgcccaccgcttcctcaccgacaccgacggtacgtccgtcgcctgg
acctaccgcgaactcgacctgcacgcccgcgaggtggccacccacctgcggcacgccggg
gtggggcagggcccggtgctgctgctgcacccgccgggcctcgactacctcgccgcgttc
ttcggctgcctgtacgccggcgccgtggccgtccccgcctacccgccggacaacgcccgg
ttcggccagaccgtgccccggctcgcggccatcgcccgggactgcgccgccacccacgcc
ctcaccacccgccgggtccgcgagaccgtcgccgccgacggcaccggccgggtcggcacc
gaactcgacggcgtgcgctggctggtgaccgaggacctctacaccggcgagtccaccacc
gcctgggaggaccccggagccacggcgcggtcgctggccttcctccagtacacctcgggt
tccaccgccgcgcccaagggcgtgatggtcgaacacggcaacctggtgcgcaacctgcgc
tccatccacctcaggctcgggcacgacgcggactccggcatggtctcctggctgccgccg
taccacgacatgggtctcatcggcggcatcctcaccccggtgtacggcggcttccccgcg
cacctcatggcgccgatgaccttcgtgcagcgcccgctgctgtggctggagaccctctcc
cgcaccggcgcctccaccagcgtggcacccaacttcggcttcgagcagtgcctgcgccgg
atcacccccgcacagcgggccggcctggacctgagccgctggcgcctggcgctgaacggt
gccgagccgatccgccccgacaccctcgaccggttcgccgagtacttcgccccggccggc
ttcgaccgcaccgcgctgctgccctgctacggcctcgccgaggcgaccctcatggtcacc
ggcgtgcggccggccgacccgccggtggtggagtccttcgacgcggcggccctggaggcg
ggcaccgcgcgtcccgcggaccccggcggcgtgcgcaccacccgcgtcgtcggctgcgga
gcacccgtcgccgacgtcgaggtcgcggtggtcgacgccgccaccggccgccgggtcccc
gacggcaccgtcgccgagatccgggtcagtggtcccggcgtcgcccgcggctactgggga
cgccccgaggccgccgccgaggtcttcggcacccggatcgacggcgaaccgggcaacgcc
tggctgcgcaccggcgacgtcgggttccgccacgacggccagctctacgtggtcggcagg
accaaggacgtgatcatcgtccagggccgcaacatccacccccaggacgtggaacagacg
gccgaacgggtcggcgccggactgcgcgccgggtacggcgccgcgttcgccgtccccacc
gccgacggcgaacagctcgccctcgcctacgagatcggcggccccggcgccggggatccg
cacgccctgctcgcccggctgcgcaccgccatcgccgacgagcaccaggtgacaccgcac
accgtcgtgctgctcaaacgctcctcggtgccgcgcaccaccagcggcaagatccagcgc
ggcgcctgccggcagcgcctgctcgacctggaactgcccgtggtggccgcgagcgtcgtc
caggacggtgccctgccggacacccccgccccgcacgcccccgcctccccggaccgtacg
gccgccctcgtcgccgacgccctcgaccgcgccgcgacggacgcgcccgacggcacctcg
cgctacccgcggctgctgaccgccgtacggacgctgtccgagcgcctcggcgtcgccctc
gacgtcggtgaactcctgtccggccccgagccggacggcgcgccgtccctcaccgggctg
tgccgcgccgcgctcgccgacgcggcgcccgcgcccacggccgcgccggagcggacccgg
acccaggccgtggactggctgcggcgggccgtcgccgcccggctgggcctgcgcccctcg
gtgatcgacacggcggtccccttcacctcactgggcctggactccaagcaggccgtggcc
ctcaccgccccgttcggcgactggctcggcacccccgtgaccccggccaccctctacgac
cacccgacggtcgagtccctggcggcccacgtcaccggaccagaggcggacggcaccccg
cacccgcacccgcggcgtcccgctcccgagcccgcccgcgggcgcgccgacgagcccgtc
gccgtgatcggcatcggctgccggttccccggcgcacccgaccccgacagctactggcgg
ctgctgcgcgacggccgcgacgccgtgggcgaggcacccgccgaccgccacggcgacacc
ggcggccggccgggcggcttcctggagcacgtgtacgacttcgacgcccgcttcttcggc
gtctccgcccgcgagaccgaacgcatggacccccagcagcggctgctcctggaggtcgcc
tggcagaccttcgaggacgcgggcatcgcgccctcctccctggccggcacggacaccggt
gtcttcgtcggcatcagcgggcacgactacgccgatctccagatgccgcaccccgacgtc
gtcgacatgtactccgccaccggcaacgcccagtccgtggcggccggccggctctcgtac
ttcttcgacctgaccgggcccagcctcgccctcgacaccgcctgctcctcctcgctcgcc
gccgtccacacggcgctgcgcagcctgcgggacggcgagtgcggcgtcgccctcgcgggc
ggcgtcaacctgatgctgacgcccgggctgtcggaggccctcgcccggggcggcatgctc
ggccccggcggacgctgccgcaccttcgacgacggcgccgacggctacgtccgcggcgag
ggcgcgggcctggtgtgcctcaagccgctgtccgccgcgctggccgacggggaccgcgtg
cacgccgtgctcaccggctccgcgctcggtcacggcggccgggccaacggcctgaccgcc
ccccgcagcaccgcccagcgtgccgtgatgaccggggcgctggagcgggccggtgtgcag
cccggacagatcgactacgtcgaggcacacggcaccggcaccgctctcggcgaccccatc
gagtgggaggccctggccggcgtctacggccgcggccgccccgccgacgcgccctgcccg
gtcggctcggtgaagaccgccatcggccacctggaggcggccgccggcatcgccgggctg
atcaaggccgtgctcgtggtgcgggagcgggaggtaccgccgctgctgcacctggccacc
cccaaccggcacctggactggacgggttcgggactgaccgtgcccaccacccgccgggcc
ctgcccgccgggggcaccctgcgcgcgggcgtcagctcgttcggcttcggcggcaccaac
gcccatgtgatcgtcgagtccgcgcccgcacccccggcgcccgccggcgagtccggcgcc
cccgacggcacggtgcacgccctgtccctgtccgcgcacaccgagtccgccctggccacc
ctggccggccgctaccgcacccacctcgcggcccaccccggcgtgccgctcgccgccctg
tgccactccgcccgcaccggccgttcccggctgccgcaccgggcggtcctcaccgcagcg
acccgggacgaactggacaccgcactggaggcgctgatccgccgggagcccgccgtggac
gtggcccgcggcggacccgcggacggcaccgcgcccaccgtcgccttcctcttcggcggc
cagggcacccagtacccgggcatgggccgcgacctctacgacgcccaccccgtcctcgcc
cgcaccctgcggcgcgccgacgcggtgctgcgcggcctgggcgagatcccgctgctcgac
ctgctcttcgacccggaccgcgccgaggacctggcccgcacccggtactgccagcccgcc
ctggtcgccctcgaagtcgccctcgccgacctgtggacgagctgcggagtacgcccggcg
gccgtgctcgggcacagcgtcggcgccctcgccgccgcctgcgtcgccggtgtcctctcc
ctggaggacgccctcacgctggcggtcgtccgcgggcgtgccatggacgaacagcccggc
gagggcgcgatgatcgcctgcgtcggcgatccggagacggtgcgcgagatcgccgccggc
cacgaccgggtggccctcgccgccgtcaacgcgccccgcaacctggtgttctccggcgcg
gccgaccggatcgcggcactccgcggcgacctggaacgcaagggggtcaccgtccggccg
ctcgccgtctcgcacgccttccactcaccgctgatggcgggcgccgccgagccgctgctg
gaggccgcgcgcgccgtcgagttccagcccccggccatcccgtggatctccgacgccacc
ggcgaacccgtgacccgggtcgacgccgagtactgggtccgccacctgctcggcaccgtg
cgcttcgccgacggcttcgcccgcctgcgcgcggggaacgccgaaggcggtctgggctgc
gacgcgttcgtcgagatcggcccgcaccccaccctgctgaacctcggccggtccgccgtc
gccgacggccccgagcccgacggacgccgcacgctgtggctgccctcgctgcgccgcggc
gcccccggccgccgcaccctgctgcggtcgctgggcggctaccagtgcgcgggcggagac
atcgactggtccgccctggacgacgaacacccgcccgcccgggtcccgttgccgcacacg
cccttcgaacgccggacctaccggttccaggcccccactcccgatcaggaaggcgatccc
atgccgtcccagcccacggtgccgggcaccgccccgacgggccccgcgggcgaggtctcc
cgcaccgtgctcgacaccgtcgcccgcgtctgcggattccccgtggccgacctgccggtg
cacgccaggctcggcctcgagctgggattcgactccctgatgcggaccgacctccagcgc
cgtctcaccgaccgcttcccccaacggatgcacacgctccaggacctgccggaggacccc
acggtgcaggacatcatcggccggctcgccgccggcgacgaccgcgacggcgaccccgcc
ggcggcgcccacaccgcccgccccgccctcgccggcaccggcccggccgcgccgccggcc
caccccgcggccgtaccggcggcgccgcccgtcccggccccgcagtacgccccgtacgga
gccttcccggccccgccccacggctacgccgtcgccgccccggtcccgcagcccggagtg
ccgtacccgtacccgtacggctacccgccgcacggtgctcccgggtacgcctactacgtc
ccccagccctaccccccgcaggcgttcccgcccccggcacccccctccccgctgcaggcg
gcccccgcccccgtacccgccgcagcccccgcccccgttcccgacccggttccggcgccc
gccgcccccgtacgtcaggagcgcgccttcgaggactgggcggagtacgcggaactccag
ggcagactccgccagacccggaccagcgggtccaacccctacggccgtacgcacgagggc
ttcaactccgcgctcgccacggtcgacggcaccaaggtcgtcaacttcgcggccttcaac
tacctggcgctctcccaccacccccgcgtgcgccaggcggccaaggacgccgtggaccgc
tacggcacctccgcctccgccaccccgctgctgttcggcgagaccccgctgcaccacgaa
ctcgaagccgagatagcacggttcatcggtaccgaggcggccatcgtgttcgccggcggc
cacgccaccaacgtcgccaccgtcggccacctgttcggcccggaggacctggtggtgcac
gacgcctggatccacgacagcaccgtgcgcggctgcatcctctcgggcgcccggcgccgg
tccttcccgcacaacgactgggccgccctcgaccgcatcctgaccggagcacgggcctcg
caccgcagggcgctcgtcgtcatcgagggcgcctacagccaggacggcgacatccccgac
ctgccgcgcttcatcgaggtcaagaagcgccacggcgccatgctgatgatcgacgaggcg
cactccatcggcgtcctgggccgcaccggccgcggcgtgggcgagcactacggcaccgac
ccggccgacgtcgacctgtggatgggcaccctcagcaaggcgctgggcagcctcggcggg
tacatcgccgcccgccgcccgatcatcgagtacctcaagttcaccgcgccgctgcacatc
ttctccaccggcatctccccggcgaacgccgccgccgccctggaggcgctgcgggtcgtc
caggacgagcccgagcgggtcgcccgggtgcaggagctggccgagttcttccgcgcaggc
gcccgcgcccgcggcctcgacgtcggcgtctcccgcctctccgcggtgatcccggtgatc
accggtgactgggagaagacgatggcgctctccaactcgctgctggagcgcggcgtcaac
gtcatgccgatcggctaccccgccgtcccgcgcgaccagtgccggctccgcttcttcatc
aacgcggaccacagcgaagcagacctcgaacactccctcgacctcctggtgtga

DBGET integrated database retrieval system