KEGG   Streptomyces coelicolor: SCO7034Help
Entry
SCO7034           CDS       T00085                                 

Gene name
SC1H10.23, SC2C3.01
Definition
(RefSeq) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sco  Streptomyces coelicolor
Pathway
sco00250  Alanine, aspartate and glutamate metabolism
sco00410  beta-Alanine metabolism
sco00640  Propanoate metabolism
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Module
sco_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO7034 (SC1H10.23)
   00650 Butanoate metabolism
    SCO7034 (SC1H10.23)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO7034 (SC1H10.23)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO7034 (SC1H10.23)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO7034 (SC1H10.23)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCO7034 (SC1H10.23)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class III
   SCO7034 (SC1H10.23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 1102472
NCBI-ProteinID: NP_733721
Kitasato: SCO7034
UniProt: Q8CJL2
LinkDB All DBs
Position
7821937..7823205
Genome map
AA seq 422 aa AA seqDB search
MTALSPHLRQATPVVAVRGEGVHIEGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVA
TLVHGQYTTVMHPPLRRLVDKLGEVLPQSLDSLFFTNSGSEAVEAALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAFRYGWDEETATRFALQEL
DYTLQTISSPADTAAVIVEPVLGEGGYVPANRAFVEGLRERADRHGFLLILDEVQTGVGR
TGRFWGHEHFGVAPDILVTAKGLASGFPLSAIAAPEELMRKAWAGSQGGTYGANAVACAA
ACATLDVVRDEKLVENAEAMGARLRHGLEAVASRNPAVGDVRGMGLMLASEFVTADGEPD
PETAARVQRAAVDEGLLLLLCGAWNQVVRMIPALVIDETAVDEGLRAWAAAVEAGTSGAA
GR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgtcgccgcaccttcgccaggccacccccgtggtggcggtccggggcgag
ggggtccacatcgagggcgaggacggccgccgctatctggacttcaccgccggtatcggc
gtcaccagcaccggccactgccacccccgggtcgtggccgccgcccaggagcaggtcgcc
accctggtccacgggcagtacaccaccgtcatgcatccgccgctgcggcgcctggtcgac
aagctcggcgaggtgctgccgcagagcctggacagcctcttcttcaccaactccggcagc
gaggcggtcgaggccgcgctgcgcctggcccgccaggccaccggacggcccaacgtgctg
gtctgccacggcggcttccacggccgtacggtggccgccgcctccatgaccacctccggc
acccgcttccggtccgggttctcaccgctgatgagcggcgtggtcgtcacccccttcccg
acagccttccgctacggctgggacgaggagaccgccacccgcttcgcgctccaggagctg
gactacaccctccagacgatctcctcgcccgccgacaccgccgccgtcatcgtggaaccg
gtcctgggcgagggcgggtacgtgcccgcgaaccgcgccttcgtcgagggcctgcgcgag
cgcgccgaccggcacggcttcctgctcatcctggacgaggtgcagaccggcgtgggccgc
accggccggttctggggccacgagcacttcggtgtcgcccccgacatcctggtcaccgcc
aagggcctcgccagcggcttcccgctctccgccatcgccgcccccgaggagctgatgcgc
aaggcctgggcgggctcgcagggcgggacgtacggcgccaacgcggtcgcgtgcgcggcg
gcctgcgccacgctggacgtcgtgcgcgacgagaagctcgtcgagaacgccgaggcgatg
ggcgcccggctgcgccacggcctggaggcggtggcgtcccggaacccggccgtcggcgac
gtacgcggcatgggactgatgctggccagcgagttcgtcaccgccgacggcgagccggac
ccggagaccgccgcccgggtgcagcgggccgccgtcgacgagggactgctcctgctgctg
tgcggggcgtggaaccaggtggtgcgcatgatcccggccctggtgatcgacgagacggcc
gtcgacgagggcctgagggcgtgggccgccgccgtcgaggccggtacgtcgggagcggcg
ggacgatga

DBGET integrated database retrieval system