Streptomyces coralus: QU709_16050 Help Entry QU709_16050       CDS       T09650                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism scoa  Streptomyces coralus Pathway scoa00400   Phenylalanine, tyrosine and tryptophan biosynthesis scoa01100   Metabolic pathways scoa01110   Biosynthesis of secondary metabolites scoa01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:scoa00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     QU709_16050 Enzymes [BR:scoa01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      QU709_16050 BRITE hierarchy Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  WLW52807 LinkDB All DBs Position 3656058..3656339 Genome browser AA seq 93 aa AA seqDB search MTATDVTGARTPEAADLISGARERIDALDDRIIGLIQERMAVSAVIQEARISSGGRRVNL SREMDVLTHYSEALGKPGTSLAMTLLELCRGRI NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaccgccaccgacgtgaccggcgcccgtacccccgaggccgccgacctgatctccgga gcccgtgagcgcatcgacgcgctcgacgaccggatcatcgggctgatccaggaacggatg gccgtgtccgccgtcatccaggaggcgcggatctcctccggcggccggcgcgtgaacctc tcccgcgagatggacgtcctcacccactacagcgaggcgctcgggaagccgggcacgtcc ctcgccatgaccctgctcgaactgtgccggggtcgtatctga

DBGET integrated database retrieval system