KEGG   Streptomyces cyaneogriseus: TU94_19840Help
Entry
TU94_19840        CDS       T03687                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00564  Glycerophospholipid metabolism
scw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TU94_19840
Enzymes [BR:scw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TU94_19840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AJP03398
UniProt: A0A0C5G081
LinkDB All DBs
Position
4670577..4672283
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAQRAESLAAMAERELDVLVVGAGVVGAGTALDAATRGLATGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLRHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLTRRHALRVAPCLKKDALVGALQYYDAQMDDARF
VATLVRTAAAYGALAANRARVTGFLREGERVVGARVQDVEAGGEYEIRAKQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVIAGGKYTTYRVMAKDAVDEAVHGLDLRVADCVTEDVPLLGAEGYRAM
WNARARIAARAGLHVVRVEHLLNRYGSLAEEVLALIADDPSLGAPLHCADDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDEGQIAREVEHYEKRV
EAERESQLQPDDLTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactggggccggcgcagcgcgccgagtcgctcgcggcgatggccgag
cgggaactggacgtgctcgtcgtgggcgcgggggtggtcggcgcgggcaccgccctcgac
gccgccacccggggcctggccaccggcctggtcgaggcgcgggactgggcgtcgggcacc
tccagccggtccagcaagctgatccacggcggcctgcgctatctggagatgctcgacttc
gccctcgtccgggaggcgctcaaggagcgcggcctgctgctggaacggctcgcgccgcac
ctggtcaagccggtgccgttcctgtatccgctgcggcacaagggctgggagcggctgtac
gccggttcgggcgtcgccctctacgacgcgatgtcgatggcccgcgggcacggccggggg
ctgcccctgcaccggcacctgacccggcgtcacgccctgcgggtcgcgccctgcttgaag
aaggacgcgctggtcggcgcgctccagtactacgacgcccagatggacgacgcccggttc
gtggcgaccctcgtccgcaccgcggcggcgtacggcgcgctggccgccaaccgcgcccgc
gtcaccgggttcctgcgcgagggcgagcgggtcgtcggcgcccgggtgcaggacgtcgag
gcgggcggcgagtacgagatccgcgccaagcaggtcgtcaacgccaccggcgtgtggacc
gacgacacccaggcgatggtgggggagcgcgggcagttccacgtccgcgcctccaagggc
atccatctggtcgtccccaaggaccgcatccactccacgaccgggctgatcctgcgcacc
gagaagtcggtgctcttcgtcatcccctggggccggcactggatcgtcggcaccaccgac
accgactgggacctggacaaggcccacccggccgcgtccagcgcggacatcgactatctg
ctcgaacacgtgaactcggtcctcgccgtgccgctcacccgcgacgacgtcgagggggtg
tacgcgggcctgcgcccgctgctggccggcgagtcggacgccaccagcaagctgtcgcgc
gagcacaccgtggcccaccccgtgccggggctggtcgtcatcgcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtggacgaggcggtgcacgggctggacctgcgg
gtcgccgactgcgtcaccgaggacgtcccgctgctcggcgccgagggctaccgggccatg
tggaacgcccgcgcgcgcatcgccgcccgcgccggactccacgtcgtgcgcgtggagcac
ctgctcaaccgctacggctcgctggccgaggaggtgctggccctcatcgccgacgacccc
tccctgggcgcgccgctgcactgcgccgacgactacctgcgcgccgagatcgtctacgcc
gcctcgcacgagggcgcccgccatctggacgacgtgctgacccgccgcacccgcatctcc
atcgagaccttcgaccggggcacccgcagcgcccgcgaggccgccgagctgatggcgccg
gtgctgggctgggacgagggccagatcgcacgggaggtcgagcactacgagaagcgggtg
gaggccgagcgggagtcgcagctccagccggacgacctgacggcggacgcggcacggctc
ggggcgccggacatcgtgccgctgtag

DBGET integrated database retrieval system