KEGG   Streptomyces cyaneogriseus: TU94_27930Help
Entry
TU94_27930        CDS       T03687                                 

Definition
(GenBank) laminin G
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
scw  Streptomyces cyaneogriseus
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TU94_27930
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TU94_27930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:scw02042]
    TU94_27930
Enzymes [BR:scw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TU94_27930
Bacterial toxins [BR:scw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   TU94_27930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR BNR_3 Laminin_G_2 DUF4185 PSD2 Laminin_G_1 Pentaxin
Motif
Other DBs
NCBI-ProteinID: AJP04710
UniProt: A0A0C5G7J1
LinkDB All DBs
Position
complement(6658722..6660611)
Genome map
AA seq 629 aa AA seqDB search
MPARPRTRPRTRLGTTLTALLALAATAASPARSGTGLPGRAPLFEEQVLFQAGREPGYAC
FRIPAIVRTTAGTLLAFAEGRVLNCGDAADIDIVLRRSTDGGRTWGPLSVVNEGGGDTHG
NPVPLVDRETGRVLLAETYNTGRADAAGCGVPCDRRPHLQYSDDDGLTWSAPRDLSGDIR
PAHWNSWYATGPVHGVQLTRGAHSGRLVFGVNAETWDGGRVTANHAALAVSDDGGENWRI
GATDTWPVPAGGPFRQKPSELTLAELADGSLLVSGREQDGTDLGHRTQAVSRDGGDTFAA
PFRALPDFATPQVQGALLRLGDRLLLSAPADPDRRRTMVVRSSYDGGATWEGVDRATVVT
RDWSGYSDLVAVDDEGTVGLLYEGGEADARDEIRFARFTEEWLAPRRGPDPVTPDLAPGA
PPAAVLGGAAVTDGAIGGAIAFDGADDAVRLPYRAALPLGTEDFTASLWFRYTAARGEQP
LLWMGGVGTTQPQVWLRAEPAHDRVQGLITARDGVSAPRSAYVRAPGARNDGRWHHLVLR
RGQGRLTLFADGAVLGTVADVPGSVSRNSPFGVHVGRRMDGRASFTGAIDEVRVWDRALT
DGEVAGLRTAGAPQGTVLSLPMDTVRPGG
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcacgaccgcgtacccgtccgcgtacccgtctcgggaccaccctgaccgcgctg
ctcgcgctcgccgcgacggccgcctcccccgcccggtccggcaccggactgcccggccgc
gcaccgctgttcgaggaacaggtcctcttccaggcgggccgggaacccggttacgcctgt
ttccgcatcccggcgatcgtgcggacgaccgccggaaccctcctcgccttcgccgagggc
cgggtcctcaactgcggggacgccgccgacatcgacatcgtcctcaggcgctccaccgac
ggcggccggacctggggcccgctgtcggtcgtcaacgagggcggcggcgacacacacggc
aacccggtcccgctcgtggaccgggagaccggccgcgtcctgctcgccgagacctacaac
accggacgggcggacgcggccggctgcggggtcccctgcgaccgccggccccatctccag
tacagcgacgacgacggtctcacctggtcggcgccgcgcgacctgagcggcgacatccgc
cccgcccactggaactcctggtacgccaccggacccgtgcacggcgtccagctcacccgc
ggcgcgcactccgggcgcctggtgttcggcgtcaacgccgagacctgggacggcggccgg
gtcaccgccaaccacgcggcgctggcggtcagcgacgacggcggggagaactggcggatc
ggcgccaccgacacctggccggtccccgccggcgggcccttccggcagaagccgtccgag
ctgaccctcgccgagctggccgacggctccctcctggtcagcggccgggaacaggacggc
accgacctcggccaccgcacccaggccgtcagccgggacggcggcgacaccttcgccgcg
cccttccgggcccttcccgacttcgccacgccccaggtgcagggcgccctgctccgcctg
ggcgaccgcctgctgctgtccgccccggccgaccccgaccgccgccgcacgatggtggtc
cgctcctcctacgacggcggcgccacctgggagggcgtggaccgcgccaccgtcgtcacc
cgggactggtccggctactccgatctggtggccgtggacgacgagggcaccgtcgggctg
ctgtacgagggcggggaggccgacgcgcgcgacgagatccgcttcgcccgcttcaccgag
gagtggctggccccgcgccgcggccccgacccggtcacaccggacctcgcgccgggcgcc
ccgcccgcggcggtcctcggcggcgccgcggtcacggacggcgcgatcggcggcgcgatc
gccttcgacggcgccgacgacgccgtacggctgccgtaccgcgcggcgctgcccctgggc
accgaggacttcacggcatcgctctggttccggtacacggcggcccgcggggagcagccg
ctgctgtggatgggcggggtgggcaccacccagccccaggtgtggctgcgggccgagccc
gcgcacgaccgcgtccagggcctgatcaccgcgcgcgacggcgtgtccgccccgcggtcg
gcctacgtacgggccccgggcgcccgcaacgacggccgctggcaccatctggtgctgcgc
cgcggccaggggcggctgaccctgttcgccgacggcgcggtgctcggcacggtggcggac
gtgcccggctcggtcagccggaactcaccgttcggcgtgcatgtgggccggcgcatggac
ggccgggcctccttcaccggggcgatcgacgaggtacgggtctgggaccgggcgctgacc
gacggggaggtcgccgggctgcgcacggccggggcgccgcagggcaccgtcctgtcgctg
cctatggacacggtgcgtcccggcggctga

DBGET integrated database retrieval system