Streptomyces sp. CFMR 7: ABE83_01205 Help Entry ABE83_01205       CDS       T04074                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism scz  Streptomyces sp. CFMR 7 Pathway scz00261   Monobactam biosynthesis scz01100   Metabolic pathways scz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ABE83_01205  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scz01008]     ABE83_01205 Polyketide biosynthesis proteins [BR:scz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ABE83_01205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  ALC25850 UniProt:  A0A0M4E089 LinkDB All DBs Position complement(329395..329613) Genome browser AA seq 72 aa AA seqDB search MTNPFEDENGTYLVLVNDEGQHSLWPAFAEVPAGWTVAHPEDTRQACLDYVEQNWTDLRP KSLIESMAADPT NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgaccaacccgttcgaggacgagaacggcacctatctggtgctcgtcaacgacgagggc cagcactccctgtggcccgccttcgcggaggtgcccgccggctggaccgtggcgcacccg gaggacacccgccaggcctgcctcgactacgtcgagcagaactggaccgacctgcggccc aagagcctgatagagagcatggcggccgatccgacatga

DBGET integrated database retrieval system