KEGG   Streptomyces sp. CFMR 7: ABE83_13465Help
Entry
ABE83_13465       CDS       T04074                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00564  Glycerophospholipid metabolism
scz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABE83_13465
Enzymes [BR:scz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ABE83_13465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: ALC27992
UniProt: A0A0M4DVN4
LinkDB All DBs
Position
complement(3336421..3338127)
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERTAALAAMAERELDVLVVGAGVVGAGTALDAATRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERFY
AGSGVALYDAMSVSSGHGRGLPVHRHLSRRRALRVAPALRKDALVGALQYYDAQMDDARF
VTELVRTAASYGAQVANRARVTGFLREGERVVGALVQDVEGGTEYEVRAKQVVNATGVWT
DDTQGLIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLQHVNSVLNTPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAACVTEDTPLLGAEGYKAL
WNARARIAARTGLHVVRVEHLLNRYGSMAEEILELILDDPTLGEPLPAADDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSARLCAELMAPVLGWDEERIDREVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgccgagcgcaccgccgcgctcgccgccatggccgaa
cgcgaactggacgtgctggtcgtcggggcgggcgtggtcggcgcgggcacggccctggac
gccgccaccagaggcctctccaccggcctggtcgaggcgcgcgactgggcgtcgggcaca
tcgagccggtcgagcaagctgatccacggggggctgcgctatctggagatgctcgacttc
gccctggtccgcgaggcgctgaaggagcgcggactcctcctggagcggctcgccccgcac
ctggtgaagccggtgcccttcctctaccccttgcagcacaagggatgggagcggttctac
gcgggctccggcgtcgcgctctacgacgcgatgtcggtctcctccggccacggccggggc
ctgcccgtccaccgccacctctcccgccgccgcgccctgcgggtcgcccccgcgctgcgc
aaggacgccctggtcggcgccctgcagtactacgacgcccagatggacgacgcccgtttc
gtcaccgagctggtccgcacggccgcctcctacggagcccaggtggccaaccgcgcccgg
gtgaccggcttcctccgcgagggcgagcgggtcgtcggcgcgctcgtgcaggacgtcgag
ggcggtacggagtacgaggtccgcgccaagcaggtggtcaacgcgaccggcgtctggacg
gacgacacccaggggctcatcggtgagcgcggccagttccacgtccgcgcctccaagggc
atacacctggtcgtccccaaggaccgcatccactccaccaccggcctcatcctgcgcacc
gagaagtccgtcctcttcgtcatcccctggggcaggcactggatcatcggcaccacggac
accgactgggacctcgacaaggcccacccggccgcctccagcgccgacatcgactacctc
ctccagcacgtcaactccgtcctcaacaccccgctgaccagggacgacgtccagggcgtc
tacgccgggctgcgcccgctgctggccggcgagtcggacgccaccagcaagctgtcccgc
gagcacacggtcgcccaccccgtccccgggctcgtcgtcgtagcgggcggcaagtacacg
acgtaccgggtcatggccaaggacgcggtggacgaggcggtgcacgggctcgaccagcgg
gtggccgcctgtgtcaccgaggacaccccgctgctcggcgccgagggctacaaggccctg
tggaacgcgcgggccaggatcgccgcccggaccgggctccatgtcgtccgggtggagcac
ctgctcaaccggtacggctcaatggccgaggaaattctggagctgatcctcgacgacccc
accctgggcgaaccgctgcccgccgccgacgactacctccgcgccgagatcgtctacgcc
gcctcccacgagggcgcccgccacctggacgacgtactgacccggcgcacccgaatctcc
atcgagaccttcgaccggggcacccgcagcgcccgcctctgcgcggagctgatggccccg
gtgctgggctgggacgaggagcggatcgaccgggaggtcgagcactacgagaagcgggtg
gaggccgagcgcgagtcccagcggcagcccgacgacctcacggcggacgcggcccggctc
ggcgcgccggacatcgtgccgatctag

DBGET integrated database retrieval system