KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1334Help
Entry
GGS_1334          CDS       T02269                                 

Gene name
ddl
Definition
(GenBank) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00473  D-Alanine metabolism
sda00550  Peptidoglycan biosynthesis
sda01100  Metabolic pathways
sda01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sda00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GGS_1334 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GGS_1334 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GGS_1334 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sda01011]
    GGS_1334 (ddl)
Enzymes [BR:sda01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GGS_1334 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sda01011]
 Precursor biosynthesis
  Amino acid ligase
   GGS_1334 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: BAM61471
UniProt: M4ZF65
LinkDB All DBs
Position
complement(1434351..1435397)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLVLLYGGRSAEREVSVLSAESVMRAVNYDKFLVKTYFISQTGQFIKTQEFSEKPA
ATERLMTNSTIQYEQQIKPSDIYEEDAVVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKRVLESAGIPQVAYTVYIDGQDLEACLTETLATLAFPIFVKPANMGSSV
GISKAQTKEELKEAIQLALTYDSRVLIEQGVVAREIEVGLLGNTEVKSTLPGEVVKDVEF
YDYKAKYIDNKITMAIPAEIDQDTMTKMRTYAESAFKALGGCGLSRCDFFLSQDGQIYLN
ELNTMPGFTQWSMYPLLWENMGLAYSDLIEELVTLAQEMFDQRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacgttagttctattatatggaggccgatcagcagaacgtgaagtctca
gtgctttcagcagagagcgtgatgcgagcagttaactatgataagtttttggtgaaaact
tattttatcagtcagacaggccaattcatcaaaacccaagaattttcagaaaagccagca
gccacagaacgcttgatgaccaatagtacgattcagtatgagcagcagatcaagccaagc
gatatctatgaagaagatgccgttgtttttccagttttacatggacctatgggagaagac
ggctctattcaaggttttttggaagtgttacgaatgccttatgtagggactaacatcctt
tcatccagtgtggctatggataaaatcaccacaaaacgtgtcttagagtcggcaggtatt
cctcaggtggcttatactgtttatattgatgggcaggacttagaagcttgtttgacagag
acgctagctaccttagcctttcctatttttgtgaagccagctaatatgggctcttcagta
ggtatttctaaagcccaaacaaaagaggaattaaaagaggctattcaattagcactgacc
tatgatagccgtgtcttgattgaacaaggtgtggttgcaagagaaatcgaagttggtctt
cttggcaatacagaggtcaagtcgaccttacctggcgaagtcgttaaggatgttgagttt
tacgactataaggctaaatacatcgataacaaaattaccatggctattcctgccgaaatt
gatcaggatacgatgactaagatgcgcacttatgcggagtctgcctttaaagctttggga
ggctgtggtttgtctcgttgtgactttttcttaagtcaagatggacagatttacctcaac
gaactaaacactatgccaggctttactcaatggtctatgtatccccttttatgggaaaat
atgggattggcttattctgatttgatagaggaactggtcacattagcgcaagaaatgttt
gatcagcgcgaaagtcaccttatttaa

DBGET integrated database retrieval system