KEGG   Saccharophagus degradans: Sde_2811Help
Entry
Sde_2811          CDS       T00335                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sde  Saccharophagus degradans
Brite
KEGG Orthology (KO) [BR:sde00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sde_2811
Enzymes [BR:sde01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sde_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO Thi4 AlaDh_PNT_C NAD_binding_8 Glutaredoxin FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABD82068
UniProt: Q21GW1
LinkDB All DBs
Position
3547392..3549008
Genome map
AA seq 538 aa AA seqDB search
MLDQTLINQLKQYVQHIKRPVELVLTLNSSDKSEELQALGEQLASLSDLISLQIDAASSK
RSPTLLVRSPDTKSEIRFSGIPLGHEFTSLVLALLHTGGHDTKQEQAILDQIKTLELPKG
AEYFEFETYISLSCQNCPEVVQALNILAAINPQIKHTMIDGALFEQEVSERKVMAVPSVF
LNGKLFGQGRMNISQILAKLDSGSAEKQKNALNEKPNFDMLIVGGGPAGASAAIYAARKG
IKTGIAAERFGGQVADTLAIENFISVKATEGPKLVSSLESHVRDYDVDIMQGQQAAKLTP
ASESQSGLVEITLTNGAVLKSRSVLLATGARWRELGVPGEQEYRGKGVAYCPHCDGPLFK
GKPVAVIGGGNSGVEAAIDLAGITSHVTLLEFGETLRADDVLVRKLKSLPNVKIITSAQT
TEVHGDGEKVTGLRYTNRETNIEHSVALAGVFVQIGLIPNSEWLGEPSGNAVKRTRYGEI
ETNSKGETSVPGVFAAGDVTTAPYKQIIVAMGSGASAALGAFDYLMRQETDESKSVAA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaactttaattaaccagctcaagcagtacgttcaacatattaaacgccca
gttgagttggtactaacactaaatagttccgacaaaagcgaagaactacaagcattaggt
gaacaactggcaagcttgagcgatttaatttcactgcaaatagatgcggcaagcagcaaa
cgcagcccaacgttactggtgcgctcgccagatacaaaaagtgaaatacgctttagtggc
attccgctaggacacgaatttacctcgctggtacttgcgttattgcacacaggtggacac
gacaccaaacaagagcaggccatactagaccaaattaaaacactagaattgccgaaaggg
gctgaatactttgaatttgaaacgtacatatctcttagctgccaaaattgcccagaggta
gtacaagcgttaaatattttggcggcaattaacccgcaaattaaacacacaatgatagac
ggcgcgctgttcgagcaagaagtaagcgagcgcaaagtaatggccgtacccagtgtattt
ttaaacggcaagttatttggccaaggccgcatgaacattagccaaatactcgctaagtta
gatagcggctcggcagagaaacaaaaaaacgcgttaaacgaaaaacctaatttcgacatg
cttatagtcggtggcggccccgcaggtgcatctgcagcgatttatgccgcgcgcaaaggc
attaaaaccggtattgccgccgaacgctttggcgggcaagtagccgatacattagccatt
gaaaactttatttcggtaaaagccacagagggcccgaagttagtttcaagcttagaaagc
cacgtacgcgattacgatgtagatataatgcaaggccaacaagccgcaaaactcaccccc
gcaagcgaatcgcaatctggcttagttgaaataacacttaccaacggcgcggtattaaaa
agccgatccgtattactcgctaccggtgcacgctggcgcgaattgggagtgccaggtgaa
caggaataccgaggcaagggcgtggcttactgcccacactgcgacggccctttatttaaa
ggtaaaccagtagcggtaattggcgggggcaactcaggcgtagaagccgctatcgattta
gccggtattacttcgcacgtaacactgcttgaatttggtgaaactttgcgagcagatgat
gtgcttgtacgaaaactaaaatcgctgcctaatgtaaaaattatcacctcggcgcaaacc
acagaggtacacggcgacggcgaaaaagtaacaggcttgcgctacaccaaccgcgaaacc
aatattgaacactctgttgcacttgcaggggtatttgtacaaataggtttaataccaaac
agcgaatggcttggtgaaccgtctggcaatgcggtaaaacgcacacgctacggcgaaatt
gaaaccaacagcaaaggcgaaacatctgtgccaggcgtatttgctgccggcgatgtaact
actgcaccctacaaacaaattattgtagctatgggcagcggcgccagtgcagcgttaggc
gcgtttgattatttaatgcggcaagaaactgatgagtcgaaatctgttgcggcttaa

DBGET integrated database retrieval system