KEGG   Steroidobacter denitrificans: ACG33_02080Help
Entry
ACG33_02080       CDS       T04296                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sdf  Steroidobacter denitrificans
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACG33_02080
Enzymes [BR:sdf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ACG33_02080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO Glutaredoxin FAD_binding_3 FMO-like NAD_binding_8 K_oxygenase AlaDh_PNT_C Thi4 YojJ
Motif
Other DBs
NCBI-ProteinID: AMN45917
UniProt: A0A127F688
LinkDB All DBs
Position
496664..498244
Genome map
AA seq 526 aa AA seqDB search
MLEANLKQQLKTYLERITQPIELLASLNDSDQSREMLQLLEEITSLSAMITLQRTDDEQR
KPSFAVRRAGSDMKLCFAGMPMGHEFTSLILALLQAGGHPPKVEESVIEQIKALEGELDF
EVFISLSCQNCPDVVQALNLMAVLNPRVRCVMIDGALFQQEVEARQIMAVPMIYLNGRKF
GQGRMTIDEILAKLDVNADARQAARIDAKEAFDVLVVGGGPGGAAAAVYAARKGIRTGLV
AERFGGQVLDTLAIENFISVPYTEGPKLAMALEEHVKRYDVDVMNLQTAQGLTPAGDDGL
ITVTLANGAALRSRTVVLATGARWRSMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVTQVTLIEFDGQLRADEVLQRKLRSLSNVRVIVSAQTTEVHGAQG
KVSGLSYRDRGSDQIHRLELEGVFVQIGLLPNTDWLKGTLALSERGEIEIDARGQTSLPG
VFAAGDATTTPYKQIVIAMGEGSKAALSAFDHLIRTSAPASKADAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagcgaatctaaaacaacagctgaaaacctacctggagcgtatcacgcagccc
atcgagcttctggcatcgctgaatgacagcgatcagtcgcgtgaaatgctgcagctcctg
gaggaaatcacgtccttgtcggcgatgattacattgcagcgtaccgacgatgaacagcgc
aagccgtcgttcgcggtccggcgtgccggctcggatatgaagttgtgcttcgcaggcatg
ccgatggggcatgaattcacctcgctgatcctggcgctgttgcaggcgggcggacacccg
cccaaggtcgaggaaagcgtcatcgaacagatcaaggcactcgaaggagaactcgatttt
gaagtcttcatttccctgagctgccagaattgtccggacgtcgtacaggcattgaatctc
atggcagtgctgaatccacgcgttcgctgcgtgatgatcgacggcgcgttattccagcag
gaagtcgaggcgcgccagatcatggccgtgccgatgatctatctaaacgggcggaagttc
ggccagggtcgcatgacgatcgacgagattcttgccaagctggatgtgaatgccgatgca
cgccaggcggcgcggatcgatgccaaggaagcattcgatgtgctggtcgtcggcggcggt
cccggcggtgcggcagcagccgtgtacgcggcgcgcaaggggattcgtacgggcctggtg
gccgaacgtttcggcggtcaggtactcgatacgctggccatcgaaaattttatctcggtg
ccgtatacggaaggcccgaagctggcgatggcgctcgaggagcatgtcaagcgctacgat
gtggatgtgatgaatctgcagacggcccaaggtctcacgcccgccggagacgatggcctg
atcacggtaacgttggcaaacggagcggccttgcgcagccgcacggtcgtgcttgcgacc
ggcgcgcgttggcgctcgatgaacgtgccgggcgagcaggagtatcgcggccgcggcgtg
gcctactgtccccactgcgatggcccgctgttcaagggcaagcgtgtcgcggtgatcggc
ggcggaaactccggcgtggaagcagccatcgatctggctggaatcgtcacccaggtgacc
ttgatcgaatttgacggccagttgcgcgccgatgaagtgctgcagcgcaagctgcgcagc
ctgtccaacgtgcgtgtgatcgtgtcggcgcaaacgacggaggtgcacggcgcccaagga
aaggtttccggattgtcctaccgtgatcgaggttcggatcagattcatcgcttggagttg
gagggcgtattcgtacaaatcggcttgctgcccaacaccgactggctcaaaggtacgctt
gcactgagcgaacgtggcgagatcgagatcgatgcgcgtggccagacctccttgccgggc
gtctttgccgcgggtgatgcgacgacgactccgtacaagcagatcgtcattgccatgggt
gaggggtccaaagcggcgctgagtgccttcgaccacctgatccgtacctcggcgccggca
tccaaggcggatgcagcctga

DBGET integrated database retrieval system