KEGG   Seriola dumerili (greater amberjack): 111231340
Entry
111231340         CDS       T05606                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111231340 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sdu04052]
    111231340 (epo)
Cytokines and growth factors [BR:sdu04052]
 Cytokines
  CSF and other factors
   111231340 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111231340
NCBI-ProteinID: XP_022614118
LinkDB
Position
Unknown
AA seq 204 aa
MGNRRTYGPNREDPVKGYADTAMEFPRLLALLLIVLEWTRPGLPSPLRPICDLRVLNHFI
KEARDAEVAMKSCRDGCSLSDSVTVPQTRVDFDVWEKKNALEQAQEVQAGLWLLQQALSL
LRSSATNTALHSHIDNSIRNLHSINAVLRSLNIQEYTPPGSAAGLEGTWTVSSAADLLQV
YVNFLRGKVRLLLSDAQACQQDVS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggcaatagacggacctatgggccaaaccgcgaggaccctgtgaagggctatgcggat
accgctatggagtttcccagactgcttgccttgctgttgatagtgttggagtggacccgg
ccaggcctaccgtccccactgaggccaatctgtgacctgagggtcctgaaccatttcatt
aaagaagcacgagacgcagaagtcgctatgaagtcatgtagagatggatgcagcctgtca
gattctgtcactgttcctcaaaccagagtcgactttgatgtctgggagaagaaaaatgca
ctggagcaagcccaggaggtgcaggctggcttatggcttttacaacaggccctcagcttg
ctacggtcctcggccaccaacacagcactgcacagtcacatagataactccattagaaac
ctgcacagcatcaatgcagtgctgcgtagtctcaacatccaggaatataccccaccagga
agtgcagctggccttgagggaacatggacggtgtcctcagcagcagatttgcttcaagtc
tatgtcaatttcttgcgaggcaaagtgcgcctcctcctttcggatgcacaggcttgtcag
caagatgtcagctga

DBGET integrated database retrieval system