KEGG   Streptomyces davaonensis: BN159_3646Help
Entry
BN159_3646        CDS       T02518                                 

Gene name
glpD2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00564  Glycerophospholipid metabolism
sdv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN159_3646 (glpD2)
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN159_3646 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 DUF5069 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CCK28025
UniProt: K4R4M7
LinkDB All DBs
Position
complement(4118635..4120290)
Genome map
AA seq 551 aa AA seqDB search
MAERELDVLVVGAGVVGAGTALDAVTRGLSTGLVEARDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHQGWERLYAGSGVALYDAMSMARGH
GRGLPMHRHLSRRHALRIAPALKKDALVGALQYYDAQMDDARYVATLVRTAAAYGAKVAN
RARVTGFLREGERVVGARVQDVEAGGEYEVHAKQVVNATGVWTDDTQAMVGERGQFHVRA
SKGIHLVVPKDRIHSVTGLILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADI
DYILEHVNSVLAVPLTRDDVQGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDEAVHGLDMRVAECVTEDIPLLGAEGYRALWNARARIAARTGLHVVR
VEHLLNRYGALTEEVLDLVAADPSLGEPLRAAEDYLRAEVVYAASHEGARHLDDVLTRRT
RISIETFDRGTLSAREAAELMAPVLGWDKDQIEREVEHYEKRVEAERESQRQPDDLTADA
ARLGAPDIVPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgcgagctggacgtgctggtcgtgggagccggcgtggtcggcgcgggcacc
gcgctcgacgcggtgacccggggcctgtccaccggtctggtcgaggcgcgtgactgggcg
tcgggcacctccagcaggtccagcaagctgatccacggcggcctgcgctatctggagatg
ctcgacttcgccctcgtccgcgaggcactcaaggaacgcgggctgctcctggaacgcctc
gccccgcacctggtcaagcccgtcccgttcctctaccccctccagcaccagggctgggag
cggctctacgccggttccggcgtcgccctctacgacgccatgtcgatggcccgcggccac
ggccggggcctgcccatgcaccgccacctgagccgccgtcacgccctgcgcatcgccccc
gccttgaagaaggacgccctggtcggcgcgctccagtactacgacgcccagatggacgac
gcgcgctatgtcgccaccctcgtccgcaccgccgccgcctacggcgccaaggtcgccaac
cgcgcccgggtcaccggattcctgcgcgagggcgaacgcgtcgtcggcgcccgcgtgcag
gacgtcgaggcgggcggggagtacgaggtccacgccaagcaggtcgtcaacgccaccggc
gtatggaccgacgacacccaggccatggtgggcgagcggggacagttccacgtccgcgcc
tccaagggcatccacctggtcgtccccaaggaccgcatccactccgtgacgggactcatc
ctccgtaccgagaaatccgtcctgttcgtcatcccctggggacggcactggatcatcggc
accacggacaccgactgggacctcgacaaggcacacccggccgcctccagcgcggacatc
gactacatcctcgaacatgtgaactccgtgctcgcggtgccgctcacccgcgacgacgtc
cagggcgtgtacgcgggcctcaggccactgctggccggcgagtccgacgccaccagcaag
ctctcgcgcgagcacaccgtggcccatccggtgccgggactcgtggtggtcgcgggcggc
aagtacacgacctaccgggtcatggccaaggacgcggtggacgaggcggtgcacggactc
gacatgcgcgtcgccgaatgcgtcaccgaggacatcccgctgctgggcgccgagggatac
cgggcgctgtggaacgcacgggcgcgcatcgcagcccgcaccgggctccatgtggtgcgc
gtggagcacctgttgaaccgctacggcgcactgacggaggaggtcctcgacctcgtcgcc
gcggacccctcactcggcgagccgctgcgggcggccgaggactatctgcgcgccgaggtg
gtgtacgccgcctcgcacgagggcgcacggcacctggacgacgtcctgacccggcgcacc
cgcatctccatcgagaccttcgaccgcggcacgctcagcgcccgcgaggccgccgagctg
atggcgcccgtgctcggctgggacaaggaccagatcgagcgcgaggtcgagcactacgag
aagcgggtggaggccgagcgggagtcccagcgccagccggacgacctgacggcggatgcg
gcgcggttgggggcgccggacatcgtgccgctctga

DBGET integrated database retrieval system