KEGG   Streptomyces davaonensis: BN159_4069Help
Entry
BN159_4069        CDS       T02518                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00250  Alanine, aspartate and glutamate metabolism
sdv00410  beta-Alanine metabolism
sdv00430  Taurine and hypotaurine metabolism
sdv00650  Butanoate metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01120  Microbial metabolism in diverse environments
sdv02024  Quorum sensing
Module
sdv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN159_4069
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN159_4069
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN159_4069
   00430 Taurine and hypotaurine metabolism
    BN159_4069
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN159_4069
Enzymes [BR:sdv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BN159_4069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCK28448
UniProt: K4R536
LinkDB All DBs
Position
4551756..4553150
Genome map
AA seq 464 aa AA seqDB search
MALHKGPERPDDRPLSVNPFYGEANPVSRMTEAPPQHRLPDSPLPPTTAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWHAPDP
AAAVGCSTTGSSEACMLAGMALKRRWSSRNTGGRPNLVMGVNVQVCWDKFCNFWEVEPRL
VPMEGDRFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALDALQERTGLDIP
VHVDGASGAMVAPFLDEDLAWDFRLPRVASINTSGHKYGLVYPGVGWALWRDKAALPEEL
VFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQTARDVASGLAGRIEA
LGDFRLLTRGDQLPVFAFTTAPDVTAYDVFDVSRRLREQGWLVPAYTFPPNREDLSVLRV
VCRNGFSTDLAALLLEDLQRLLPELRRQPHPLGRDAGQATAFHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcacaaagggcccgaacggcccgacgaccgtcccctgtccgtcaaccccttc
tacggcgaggccaatccggtcagccggatgaccgaggcgccgccccagcaccggctcccg
gacagcccgctgccgccgacgacggcgtaccagctcgtccatgacgaactgatgctggac
ggcaactcccggctgaacctggccaccttcgtcaccacctggatggagccgcaggccggg
gtgctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgaactggagcgacgctgtgtggcgatgctcgccgacctgtggcacgcgcccgacccg
gcggcggccgtgggctgttcgaccaccgggtccagcgaggcctgcatgctcgccgggatg
gcgctcaagcgccgctggagcagccggaacacgggcggtcgtccgaacctggtcatgggc
gtcaacgtccaggtctgctgggacaagttctgcaacttctgggaggtggagccccggctg
gtgcccatggagggcgaccgcttccacctcgacccccaggccgcggccgagctgtgcgac
gagaacaccatcggcgtcgtgggcatcctcggctccaccttcgacgggtcctacgaaccc
atcgccgatctgtgcgccgcccttgacgccctccaggaacgcaccggcctcgacatcccg
gtccatgtcgacggcgcctccggggcgatggtcgcgcccttcctcgacgaggacctggcg
tgggacttccgcctcccgcgcgtggcgtccatcaacacttccgggcacaagtacgggctc
gtctacccgggcgtcggctgggcgttgtggcgggacaaggcggcactgcccgaggaactg
gtgttccgcgtgaactacctgggcggcgacatgccgaccttcgcgctgaacttctcccgg
cccggcgcccaggtcgtcgcgcagtactacaccttcctgcggctgggccgggagggctac
cgggccgtccagcagaccgcccgggacgtcgcgagcggactcgccgggcgcatcgaggcc
ctcggcgacttccgactgctcacccggggcgaccagttgccggtcttcgccttcaccacg
gcgcccgatgtgacggcgtacgacgtcttcgacgtctcccgcaggcttcgcgagcagggc
tggctggtgcccgcgtacaccttcccgccgaaccgggaagacctgtccgtgctccgggtg
gtgtgccgcaacggcttctccacggacctcgcggcgctgctcctggaggacctccagcgg
ctgctgccggaactgcggcggcaaccgcatcccttggggcgtgacgccggccaggcgacc
gcgttccatcactag

DBGET integrated database retrieval system