KEGG   Shigella dysenteriae Sd197: SDY_0541Help
Entry
SDY_0541          CDS       T00306                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sdy  Shigella dysenteriae Sd197
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SDY_0541 (ahpF)
Enzymes [BR:sdy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SDY_0541 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 3797336
NCBI-ProteinID: YP_402235
ShiBASE_China: SDY0541
UniProt: Q32IW1
LinkDB All DBs
Position
526244..527839
Genome map
AA seq 531 aa AA seqDB search
MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKV
TFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLE
QIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMG
VPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIY
SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSA
TKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIIL
NAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAAERNRMGEI
IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtttaaagcccaggagataaatatgctcgacacaaatatgaaaactcaactc
aaggcttaccttgagaaattgaccaagcctgttgagttaattgccacgctggatgacagc
gctaaatcggcagaaatcaaggaactgttggctgaaatcgcagaactgtcagacaaagtc
acctttaaagaagataacagcttgccggtgcgtaagccgtctttcctgatcaccaaccca
ggttctaaccaggggccacgttttgcaggctccccgctgggccacgagttcacctcgctg
gtactggcgttgctgtggacaggtggtcatccgtcgaaagaagcgcagtctctgctggag
cagattcgccatattgacggtgattttgaattcgaaacctattactcgctctcttgccac
aactgcccggatgtggtgcaggcgctgaacctgatgagcgtactgaacccgcgcatcaag
catactgcaattgacggcggcaccttccagaacgaaatcaccgatcgcaacgtgatgggc
gttccggcagtgttcgtaaacgggaaagagtttggtcagggccgcatgacgttgactgaa
atcgttgccaaaattgatactggcgcggaaaaacgtgcggcagaagagctgaacaagcgt
gatgcttatgacgtattaatcgttggttccggcccggcgggtgcagcggcagcaatttac
tccgcacgtaaaggcatccgtaccggtctgatgggcgaacgttttggtggtcagatcctc
gataccgttgatatcgaaaactacatttctgtaccgaagaccgaaggccagaaactggca
ggtgcgctgaaagttcacgttgatgaatacgacgttgatgtgatcgacagccagagcgcc
accaaactaatcccggcagcggttgaaggtggtctgcaccagattgaaacagcttctggc
gcggtactgaaagcacgcagcattatcgtggcgaccggtgcaaaatggcgcaacatgaac
gttccgggcgaagatcagtatcgcactaaaggcgtgacctactgcccgcactgcgacggc
ccgctgtttaaaggcaaacgcgtagcggttatcggcggcggtaactccggcgtggaagcg
gcaatcgacctggcgggtatcgttgagcacgtaacgctgctggaatttgcgccagaaatg
aaagccgaccaggtgctgcaggacaaactgcgcagcctgaaaaacgtcgacattattctg
aatgcgcaaaccacggaagtgaaaggcgacggcagcaaagtcgttggtctggaatatcga
gatcgtgtcagcggcgatattcacaacatcgaactggccggtattttcgtccagattggt
ctgctgccgaacaccaactggctggaaggcgcagccgaacgtaaccgcatgggtgagatt
atcattgatgcgaaatgcgaaaccaacgtcaaaggcgtattcgcagcgggtgactgtacg
acggttccgtacaagcagatcatcatcgccactggcgaaggtgccaaagcctctctgagt
gcttttgactacctgattcgcaccaaaactgcataa

DBGET integrated database retrieval system