KEGG   Shigella dysenteriae Sd197: SDY_1390
Entry
SDY_1390          CDS       T00306                                 

Gene name
stxB
Definition
(RefSeq) Shiga toxin subunit B
  KO
K11007  shiga toxin subunit B
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy02024  Quorum sensing
sdy05131  Shigellosis
Module
sdy_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SDY_1390 (stxB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SDY_1390 (stxB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sdy02042]
    SDY_1390 (stxB)
Bacterial toxins [BR:sdy02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    SDY_1390 (stxB)
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-GeneID: 3796556
NCBI-ProteinID: YP_403026
ShiBASE_China: SDY1390
UniProt: Q32GM0
LinkDB
Structure
PDB: 
1R4Q 1DM0

Position
1284822..1285091
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system