KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_2579
Entry
SCH_2579          CDS       T00240                                 

Gene name
gogB
Definition
(GenBank) Gifsy-1 prophage leucine-rich repeat protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sec00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    SCH_2579 (gogB)
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-ProteinID: AAX66485
UniProt: Q57LC7
LinkDB
Position
2749431..2750927
AA seq 498 aa
MVLTYRLKKRMKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIE
ANHTGSLSITAHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISY
FPDSLESLSIDMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFPEISCA
ELPYKLDKLDLQNCPFLPLMKMLPEGLKELSIELIQTVPGTVIDDILPDKLKKLSINFCD
NIKLPVKLPVNLKSINLSSRTPIVWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSN
KPAGDALSFQPGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFN
KDEKIAERLNDVQRGTFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRE
RSVIFVIDNLVDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISH
EDVFSLVGWDKYKPKNGV
NT seq 1497 nt   +upstreamnt  +downstreamnt
ttggtattgacatatagattgaaaaagcgcatgaaaataggattccaaccagccatattg
caatatgcatatacaagtaacgaggcgacatcaaaccttgagttattaaataaatggaga
atagaatccccagatattgagaaggaggagcgtaatagtatttacgacaaaataatagaa
gcaaatcataccgggagcttatcaattactgctcatcatgttacctctattccggtattt
cctgataatttatccgagttgaatttatcttcatgctatacactggagtctattccaaat
cttcctgatgggttaaaaagtttaactatatctggaaatcagaccattaaaatttcatat
ttcccagatagcttagagtcactatctatagatatgcaggcatatgaagaaaattatact
ttccccgcattaccttatggattaaagagttttactgcgtgctatggtaaatttttgcct
ccccttcctccgcatctatcttctttgtcattgcaaaatttccctgaaatatcatgtgct
gagttaccatataaattagataaattagacttacaaaattgccctttcttgccattaatg
aaaatgttacctgaggggttaaaagaactaagtattgaacttatacaaacagttcccggt
actgttatagatgatattttgcctgataagctaaaaaaattaagtatcaacttttgtgat
aatattaaacttccagttaagcttcctgttaatttaaagtctatcaatttatcctcaagg
acccctattgtatgggaaataccaacctgcaatctgcctgcacatatagatattagtacc
gatggttatgttaagcttaatcctgaatttcttaccaggagtgatattacctttagtaac
aaacctgcaggagatgcgttaagttttcagcctggagatgtggtttatggtttatgtaag
gcaagagatcgagtaaatactttagttaattcgttatattatttttcaaaaaaagatatt
attattcaaaatacattaacagatgcggtctgggacaggaagaatagagccgtgtttaat
aaagatgagaagatagcagaaagattgaatgatgttcagagagggactttttttagagaa
tttttatctcaacataaaaaatacaatattaccgaagataaatattcagacttatccaat
gaggagtgctggataaaaacaagtaaagccggtcttgaattccaaacacgattaagggaa
cggtcagttatttttgtcattgacaatttagttgatgctataagtgatatcgcaaataaa
acaggaaagcatggtaattctattacagcacatgagctaagatgggtatatcggaatcga
catgatgatctggtaaaacaaaatgttaaattttttcttaatggtgaggctatttcacac
gaagatgttttttcattagttggttgggataaatataagcctaaaaatggagtgtga

DBGET integrated database retrieval system