KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4453Help
Entry
SeD_A4453         CDS       T00757                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SeD_A4453 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACH74065
LinkDB All DBs
Position
4293491..4294111
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPVEELITK
LDQVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttatgatgcactggaaccgcacttcgat
aagcagacgatggagattcaccacaccaaacaccatcaaacctatgtcaacaacgctaac
gcggcgctggaaaacctgcctgagtttgctgacctgccggttgaagaactgattactaaa
ctggaccaggtgccagcggacaaaaaaaccgtgctgcgtaacaacgccggcggtcacgct
aaccacagcctgttctggaaaggactgaaaaaaggcaccactctgcagggcgatctgaaa
gcggctatcgagcgtgacttcggttccgttgacaacttcaaagctgaattcgaaaaagca
gcagcaacccgtttcggctccggctgggcgtggctggtgctgaaaggcgacaaactggct
gtggtttctaccgcaaaccaggattccccgctgatgggtgaagccatttccggcgcttcc
ggcttcccgatcctgggtctggacgtgtgggaacacgcttactatctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system