KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_13075Help
Entry
SEEH1578_13075    CDS       T02736                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00020  Citrate cycle (TCA cycle)
seeh00190  Oxidative phosphorylation
seeh00650  Butanoate metabolism
seeh01100  Metabolic pathways
seeh01110  Biosynthesis of secondary metabolites
seeh01120  Microbial metabolism in diverse environments
seeh01130  Biosynthesis of antibiotics
seeh01200  Carbon metabolism
Module
seeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seeh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
seeh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SEEH1578_13075 (sdhB)
   00650 Butanoate metabolism
    SEEH1578_13075 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SEEH1578_13075 (sdhB)
Enzymes [BR:seeh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SEEH1578_13075 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SEEH1578_13075 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AGQ64208
LinkDB All DBs
Position
2640626..2641342
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgtatg
caggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgttaatc
cagcttaaagaaaaagatcccagcctttctttccgccgttcctgccgcgaaggtgtgtgc
ggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatttcg
gcgctgactcagccgggtaagaagattgtgattcgcccgctgcccggtttgccggtgatc
cgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatccaccggctcgtgagcatctgcagatgccggagcagcgt
gaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgcccg
tcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtatcga
ttcctgatcgatagtcgtgataccgagactgacagtcgtctggaagggatgagcgatgca
ttcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaagggactg
aacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcataa

DBGET integrated database retrieval system