KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3003Help
Entry
SG3003            CDS       T00770                                 

Gene name
yggH
Definition
(GenBank) conserved hypothetical protein
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Brite
KEGG Orthology (KO) [BR:seg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seg03016]
    SG3003 (yggH)
Enzymes [BR:seg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     SG3003 (yggH)
Transfer RNA biogenesis [BR:seg03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    SG3003 (yggH)
 Prokaryotic type
    SG3003 (yggH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_4 Methyltransf_25 Methyltransf_3 DUF1263
Motif
Other DBs
NCBI-ProteinID: CAR38808
UniProt: B5RE69
LinkDB All DBs
Position
complement(3133157..3133876)
Genome map
AA seq 239 aa AA seqDB search
MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQEHALENYWPVMGVEFSEAPVDFATLF
GREAPVTLEIGFGMGASLVAMAKARPEQNFLGIEVHSPGVGACLASAHEEGVENLLVMCH
DAVEVLHKMIPDNSLSMVQLFFPDPWHKARHNKRRIVQVPFAELVLSKLKLGGVFHMATD
WEAYAEHMLEVMSSIDGYKNLSESNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgacgtcatttcaccggaatttgatgaaaacggtcgcccgctgcgccgtatt
cgtagttttgttcgtcgccaggggcgactgacaaaggggcaagaacacgcgctggaaaac
tactggccggtgatgggcgtcgagttcagcgaagcgccggtagatttcgccacgttgttt
ggtcgcgaagcgccggtgacgctggagattggttttggcatgggggcgtctctcgtggcg
atggcgaaagcgcgcccggagcagaatttcctcggcattgaagtgcattcacccggtgtc
ggcgcgtgtctggcatccgctcatgaagagggcgttgaaaacctgctcgtcatgtgccac
gacgcggtagaagtgttgcataaaatgattcctgacaattctttatcgatggttcagctc
tttttccctgacccgtggcataaagcgcgtcataataaacgccgtatcgttcaggtgccg
tttgctgaactggtattgagcaagctgaaattgggcggcgttttccatatggcgaccgat
tgggaagcgtatgcggaacacatgcttgaagtcatgtcttctatcgacgggtacaaaaat
ctgtcagagagcaatgattatgtaccgcgcccggaatcgcgcccggtaacgaaatttgaa
caacgtggccatcgtcttggtcatggcgtatgggacttaatgttcgagagggtgaaataa

DBGET integrated database retrieval system