KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1065
Entry
SPC_1065          CDS       T00862                                 

Gene name
gogB
Definition
(GenBank) leucine-rich repeat protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sei00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    SPC_1065 (gogB)
SSDB
Motif
Pfam: LRR_4 FNIP
Other DBs
NCBI-ProteinID: ACN45231
UniProt: C0PYG4
LinkDB
Position
complement(1105022..1106488)
AA seq 488 aa
MKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEANHTGSLSIT
AHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFPDSLESLSI
DMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFPEISCAELPYKLDKLD
LQNCPFLPLMKMLPEGLKELSIELIQTVPGTVIDDILPDKLKKLSINFCDNIKLPVKLPV
NLKSINLSSRTPIVWEIPTSNLPAHIDISTDGYVKLNPEFLTRSDITFSNKPAGDALSFQ
PGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKDEKIAERLN
DVQRGTFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERSVIFVIDNL
VDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHEDVFSLVGWD
KYKPKNGV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaaaataggattccaaccagccatattgcaatatgcatatacaagtaacgaggcgaca
tcaaaccttgagttattaaataaatggagaatagaatccccagatattgagaaggaggag
cgtaatagtatttacgacaaaataatagaagcaaatcataccgggagcttatcaattact
gctcatcatgttacctctattccggtatttcctgataatttatccgagttgaatttatct
tcatgctatacactggagtctattccaaatcttcctgatgggttaaaaagtttaactata
tctggaaatcagaccattaaaatttcatatttcccagatagcttagagtcactatctata
gatatgcaggcatatgaagaaaattatactttccccgcattaccttatggattaaagagt
tttactgcgtgctatggtaaatttttgcctccccttcctccgcatctatcttctttgtca
ttgcaaaatttccctgaaatatcatgtgctgagttaccatataaattagataaattagac
ttacaaaattgccctttcttgccattaatgaaaatgttacctgaggggttaaaagaacta
agtattgaacttatacaaacagttcccggtactgttatagatgatattttgcctgataag
ctaaaaaaattaagtatcaacttttgtgataatattaaacttccagttaagcttcctgtt
aatttaaagtctatcaatttatcctcaaggacccctattgtatgggaaataccaaccagc
aatctgcctgcacatatagatattagtaccgatggttatgttaagcttaatcctgaattt
cttaccaggagtgatattacctttagtaacaaacctgcaggagatgcgttaagttttcag
cctggagatgtggtttatggtttatgtaaggcaagagatcgagtaaatactttagttaat
tcgttatattatttttcaaaaaaagatattattattcaaaatacattaacagatgcggtc
tgggacaggaagaatagagccgtgtttaataaagatgagaagatagcagaaagattgaat
gatgttcagagagggactttttttagagaatttttatctcaacataaaaaatacaatatt
accgaagataaatattcagacttatccaatgaggagtgctggataaaaacaagtaaagcc
ggtcttgaattccaaacacgattaagggaacggtcagttatttttgtcattgacaattta
gttgatgctataagtgatatcgcaaataaaacaggaaagcatggtaattctattacagca
catgagctaagatgggtatatcggaatcgacatgatgatctggtaaaacaaaatgttaaa
ttttttcttaatggtgaggctatttcacacgaagatgttttttcattagttggttgggat
aaatataagcctaaaaatggagtgtga

DBGET integrated database retrieval system