KEGG   Saccharopolyspora erythraea: SACE_3766Help
Entry
SACE_3766         CDS       T00492                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00250  Alanine, aspartate and glutamate metabolism
sen00410  beta-Alanine metabolism
sen00640  Propanoate metabolism
sen00650  Butanoate metabolism
sen01100  Metabolic pathways
sen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SACE_3766 (gabT2)
   00650 Butanoate metabolism
    SACE_3766 (gabT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SACE_3766 (gabT2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACE_3766 (gabT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sen01007]
    SACE_3766 (gabT2)
Enzymes [BR:sen01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SACE_3766 (gabT2)
Amino acid related enzymes [BR:sen01007]
 Aminotransferase (transaminase)
  Class III
   SACE_3766 (gabT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAM03037
Cambridge: SACE_3766
Kitasato: SACE_3766
UniProt: A4FG62
LinkDB All DBs
Position
complement(4120698..4121966)
Genome map
AA seq 422 aa AA seqDB search
MESIMAELSPVLKQATPVLAARGEGVYLFDEDDRRYLDFTAGIGVTSTGHCHPRVVEAAQ
RQVGTLIHGQYTTVMHRPLLRLTERLGEVLPSGLDRVFYVNSGSEAVEASVRLARQATGR
QNIVAFEGGFHGRTMGAGALTSSGVKIRAGLGPMMPGVAFSPFPETYRHGWSQAEAVRFA
LRELDQLLLTVTSPADTAAFIIEPVLGEGGYIPAPPEFLEGLRERADRHGILLIVDEVQT
GVGRTGRFWGHDHAGIRPDIIITAKGLASGFPLSAIAAGQELMSKAWPGSQGGTYGGNAV
AAAAALATLDVVRDENLVDNAAEQGARLKEGLRKVAAEYPVIGDVRGLGLMVGNEFTTDD
GRPDTATATRAHKAAAERGLLLLTCGPHGNVVRMIPPLVVNSQQVDEAVSLWSEAVKNAV
SG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggagtcgatcatggctgagctctcaccggtgctgaagcaggccacgcccgtgctggcc
gcccgaggggaaggcgtctacctcttcgacgaggacgatcgccgctacctggacttcacc
gccggtatcggggtgaccagcaccggccactgccacccgcgcgtggtggaagccgcccag
cgccaggtgggtaccctcatccacggccagtacacgacggtgatgcaccggccgctgctg
cggctgaccgagcggctcggcgaggtgctcccgtccggactggaccgcgtcttctacgtc
aactccggcagcgaggccgtcgaggcctcggtgcggctggcgcgccaggccaccgggcgg
cagaacatcgtggccttcgaaggcggcttccacggccgcaccatgggcgccggcgcgctg
acctcctccggggtcaagatccgcgcgggcctcggcccgatgatgcccggggtggccttc
agcccgttcccggagacctaccggcacggctggtcgcaggccgaggcggtgcgcttcgcg
ctgcgcgagctcgaccagctgctgctcaccgtcacctcgcccgccgacaccgcggcgttc
atcatcgagccggtgctgggcgagggcggctacatcccggcgccgccggagttcctggag
ggcctgcgcgagcgcgccgaccgccacggcatcctgctcatcgtcgacgaggtgcagacc
ggcgtcgggcgcaccggcaggttctggggccacgaccacgccggcatccgccccgacatc
atcatcaccgccaagggcctggccagcggcttcccgctgtcggcgatcgcggccggacag
gagctgatgagcaaggcctggcccggctcgcagggcggcacctacggcggcaacgccgtg
gccgcggccgccgcgctggccaccctcgacgtcgtacgtgacgaaaacctcgtcgacaac
gccgcagagcagggcgcccgcctgaaggagggcctgcgcaaggtcgccgccgagtacccg
gtcatcggtgatgtcaggggcctggggctgatggtgggcaacgagttcaccaccgacgac
ggccggcccgacaccgccaccgcgacccgggcacacaaggccgccgccgagcgcggtctg
ctgctgctgacctgcggtccgcacggcaacgtggtgcggatgatcccgccgctggtggtc
aactcccagcaggtcgacgaggcggtctcgctgtggtccgaggccgtcaagaacgccgtc
tccggctga

DBGET integrated database retrieval system