KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_09750Help
Entry
IA1_09750         CDS       T02868                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00500  Starch and sucrose metabolism
sene01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IA1_09750
Enzymes [BR:sene01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     IA1_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AGX10885
LinkDB All DBs
Position
2015923..2017407
Genome map
AA seq 494 aa AA seqDB search
MKNPTLLQYFHWYYPDGGKLWSELAERADGLNDIGINMVWLPPACKGASGGYSVGYDSYD
LFDLGEFDQKGTIATKYGDKRQLLTAIDALKKNNIAVLLDVVVNHKMGADEKERIRVQRV
NQDDRTQIDDNIIECEGWTRYTFPARAGQYSNFIWDYHCFSGIDHIENPDEDGIFKIVND
YTGDGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQAVAPKPLFIVAEYWSHEVDKLKTYIDQVDGKTMLFDAPLQMKFHEAS
RQGAEYDMRHIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGASYEDSGENGETCRVDMPVINQLDRLILARQSFAHGIQTLFFDHPNCI
AFSRSGTEENPGCVVVLSNGDDGEKNLLLGDNYANKTWRDFLGNRSEHVVTNDQGEATFF
CNAGSVSVWVIEDV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttattgcagtacttccactggtattatcccgacggcggtaaactc
tggtctgagctggcggaacgtgctgatgggctgaatgatatcggtatcaatatggtctgg
ctaccgcccgcctgtaaaggcgcctccggcggctattccgtaggctatgatagctacgac
ctgtttgacctcggcgaatttgaccaaaaaggaactatcgcgacaaagtacggcgataaa
cgccagttactgacggcgatagacgcgctcaaaaaaaataatattgcggtgctgctcgac
gtcgtcgtgaaccacaaaatgggcgcagacgaaaaagaacgtattcgcgttcagcgcgtg
aatcaggatgaccgcacgcaaatcgatgacaacatcattgaatgcgaaggctggacgcgc
tacaccttccctgcccgcgcgggccagtattccaactttatttgggactatcactgtttc
agcggcattgatcacatcgagaatcccgacgaagacggcatttttaagatcgtcaatgac
tataccggcgatggctggaacgatcaggttgatgatgagctgggtaatttcgactatctg
atgggggaaaatatcgattttcgcaatcacgcggttacggaagagattaaatattgggct
cgttgggtcatggaacaaacccactgtgacggctttcgcctggacgcggtaaaacatata
cccgcctggttttataaagaatggattgagcatgtacaggcggttgcaccaaaaccgctg
tttattgtcgcagaatactggtcgcatgaagtggataaactgaaaacgtacatcgatcag
gtcgacgggaaaaccatgctgttcgacgcgccgttgcagatgaaatttcacgaggcctcg
cgccagggcgcggagtatgacatgcgccacattttcaccggcacgctggtagaagccgac
ccttttcatgcggtgacgctggtcgctaaccacgatacacaaccgttacaggcgctggaa
gcgccggtagaaccctggttcaaaccattggcctatgcgctgatcctgcttcgtgaaaac
ggcgtgccgtcggtgttttatcccgatttatacggcgccagctatgaggatagcggcgaa
aatggcgagacctgtcgggtcgacatgccggtgattaaccaactggatcggctgatcctc
gctcgtcagagttttgcgcacggtatacaaacactctttttcgatcatcctaactgtatc
gcctttagtcgcagcggtactgaagagaatccaggctgtgtggttgtactttccaatggc
gacgacggtgaaaaaaacctcctgctcggcgacaattacgctaacaagacctggcgtgat
tttctgggaaaccgcagtgagcatgttgtaactaatgatcaaggcgaagcgacgttcttc
tgcaacgcaggcagcgtcagcgtgtgggtcattgaggacgtgtga

DBGET integrated database retrieval system