KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_21775
Entry
TY21A_21775       CDS       T02648                                 

Definition
(GenBank) hypothetical protein
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: AGK69785
LinkDB
Position
4441239..4442744
AA seq 501 aa
MTTSSYLEYILTILGWVVNNGLWDVLTGTGLFALPLGFKIIGIWIKTREEGDDEGNKGIL
SARRMEHAIYGAFIVIIACCVPTQTVSLTTLTFDTTRAKQCGFWTPVKPGDSGYGSVVST
MSGMTASAPVWWAFMHMISKGVTQAAVASLPCRPDLRQVRFDVQHTQITNPALAQELQDF
TSDCYAQAFALWKRQDAGRTTDIDVLRDIEWLGSKIFLKDFYPQLHSKLPRSAFPWSQSR
DDGYANTGQGGYPTCSEWWSQNKTGLKSRVLDTVNTTTMTRMAAAFKGMVSKEEYTEALI
RRLVSPTSLSVSQNGRTYAGYGGNADFTLDNAVNRMASVLGTSVGALGAFPAFDAMRQAL
PMVQALLLMAMYVLIPLVLVFGTYEYKTVVTLTFVTFGMHFLTFWWELARWLDSWLLEIM
YGSDSHSRWNVAGFQNSADDLIMNFVMGTMFLVLPAVWMGALSWAGVRIGGIVDTNLNKG
VQPAGQHGGKVGDKIGSGIAK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgacgacatcgagctatcttgagtacatcctgacgattctgggctgggttgttaataac
ggtttgtgggatgttctgacaggcacgggactttttgcattaccactgggctttaaaatc
attggtatctggatcaaaacacgggaagaaggggatgatgagggtaataaaggtatcctg
tcggcccgacggatggaacatgctatttacggggcatttatcgttattatcgcctgctgt
gtccccactcagacagtgtcactgacaacgctgacgtttgatacaacccgtgcgaaacag
tgtggtttctggacaccggtcaagcccggggattcaggctacggtagtgtggtttcaaca
atgagtggtatgactgcatctgcgccggtgtggtgggcatttatgcatatgatttccaaa
ggcgtcactcaggcggctgtggcaagtttaccctgccggccagacctgcggcaggtgcgt
tttgacgttcagcatacgcagatcaccaatcctgctctggctcaggaattgcaggatttt
accagtgactgttatgcacaggcttttgcgttatggaaacggcaggatgcggggagaact
acggatattgatgtactcagggatattgaatggctggggtcgaaaatatttttgaaggat
ttttacccgcagctgcattcgaagttgcccaggtcagcgttcccctggtcgcaaagccgc
gatgacgggtacgcaaataccgggcagggggggtatccaacgtgtagcgagtggtggtct
cagaacaagacaggcctgaaatcccgtgtgctggatacggtaaataccaccacgatgaca
cgcatggcggcagcatttaagggaatggtcagcaaagaggaatacacggaagcgctaatt
cgacgtctggtcagtccgacaagtctctctgtgtcacagaatggacgtacttatgcaggt
tatggcggtaatgccgattttacgttagataatgctgtaaatcgcatggcttcagtgctg
gggaccagtgtgggtgcccttggggcgttccccgcatttgatgccatgcgccaggcgtta
ccgatggttcaggcacttttattgatggccatgtatgtactaatccccctggtgctggta
ttcgggacgtatgaatataagacagtagtcactctcacttttgtgacgtttgggatgcat
tttcttacgttctggtgggagctggcgcgctggctggatagctggcttctggagatcatg
tatggttcggacagccatagccgatggaatgtggccggttttcagaatagcgcagatgac
ctgatcatgaactttgttatggggacgatgttcctggtgttgccggcagtgtggatgggg
gcgctttcctgggctggggttagaattggcggcattgttgacactaacttaaataaggga
gtgcagccagctggacagcatggtggcaaagttggtgataaaattggctcgggaatagct
aaataa

DBGET integrated database retrieval system