KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_0708Help
Entry
STM14_0708        CDS       T01714                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase F52a subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
KEGG Orthology (KO) [BR:seo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STM14_0708 (ahpF)
Enzymes [BR:seo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     STM14_0708 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: ACY87220
UniProt: A0A0F6AY98
LinkDB All DBs
Structure
PDB: 

Position
671831..673513
Genome map
AA seq 560 aa AA seqDB search
MFQSWAHPRPFHFSTMTQVALMQSREVGLHDDVFREGRRMLDTNMKTQLRAYLEKLTKPV
ELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAGS
PLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLSCHNCPDVVQALNL
MAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEK
RAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGLMGERFGGQVLDTVDIENYISV
PKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEGGLHQIETASGAVLKARSIIIA
TGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHV
TLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVA
LAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSVKGVFAAGDCTTVPYKQIIIAT
GEGAKASLSAFDYLIRTKIA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcagtcatgggcgcacccgcgcccatttcatttcagcaccatgacgcaagttgca
ttaatgcagtcccgcgaagtcggcttgcatgatgatgttttcagagagggaagaagaatg
ctcgacacaaatatgaaaacccagctcagggcttaccttgagaaactgaccaaacctgtt
gagctgattgccacgctggatgacagcgctaaatcggcggaaatcaaggaactgctggct
gaaatcgccgagctgtccgacaaagtcacgtttaaagaagacaatactctgccggtgcgc
aagccgtctttcctgattacgaatccaggttctcagcaagggccgcgctttgccggttct
ccgctgggccacgaatttacctcgctggttttggcgctgctgtggaccggcggtcatccg
tcaaaagaagcgcagtcgctgctggagcagattcgcgatattgacggcgattttgaattc
gaaacttattattcactctcctgccataactgcccggacgtagtgcaggcgctgaacctg
atggcggtgctgaacccgcgtattaaacatacggcaattgatggcggcaccttccagaac
gaaatcaccgaacgtaacgtgatgggcgttccggcggtatttgttaacggtaaagagttc
ggccagggacgtatgactctgaccgagattgtcgctaaagtggatactggcgcagaaaaa
cgcgcggcggaagcgctgaacaaacgcgatgcgtatgacgtactgattgtcggctccggc
ccggcgggcgcggcggcggcggtctactcggcgcgcaaaggcatccgtaccggtctgatg
ggcgagcgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatctcggtg
ccgaaaaccgaaggccagaaactggcgggcgcgctgaaagcgcatgtcagcgattacgac
gttgacgttatagacagccagagcgcaagtaaactggttccggccgcaacagaaggcggc
ttgcatcagattgaaacggcgtccggcgcagtattgaaagcgcgtagtatcatcatcgcc
accggcgcgaaatggcgcaatatgaatgtgccgggcgaggatcagtatcgcaccaaaggc
gtcacctattgtccgcactgcgacggtccgttatttaaagggaagcgtgtggcggtcatc
ggcggcggcaactctggcgttgaagcggctatcgatctggcaggtattgtagaacatgtt
acgttgctggagttcgcgccggagatgaaggcggatcaggtgctacaggacaaagtgcgt
agtctgaaaaatgtcgatatcattttgaatgcgcaaacgacagaagtgaagggcgacggc
tcgaaagtggtgggactggagtatcgtgaccgtgtcagcggcgatattcatagcgtcgcg
ctggcagggatttttgtgcagattggtctgttgccgaatacccactggctggaaggcgcg
cttgagcgtaaccgcatgggcgagatcattattgacgccaaatgtgaaaccagcgttaag
ggcgtcttcgccgcaggcgattgcaccaccgttccttacaaacagattatcatcgccacg
ggcgaaggggcgaaagcctcgttgagcgcctttgattatctgattcgcaccaaaatcgca
taa

DBGET integrated database retrieval system