KEGG   Serratia sp. ATCC 39006: Ser39006_001385Help
Entry
Ser39006_001385   CDS       T05290                                 

Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sera  Serratia sp. ATCC 39006
Brite
Enzymes [BR:sera01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ser39006_001385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AUH02910
UniProt: A0A2I5T222
LinkDB All DBs
Position
297567..298193
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHSKHHQAYVNNTNAALESCPEFASLSVEELITK
LDQVPAEKKTALRNNAGGHANHCLFWKGLKLGTTLTGDLKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKADGKLAIASTANQDSPLMGEAISGISGYPILTLDVWEHAYYLKFQ
NRRPDYIKSFWNVVNWDEAAKRFAEASK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattccctgccatccctgccttatgcttatgacgcactggaacctcatttcgat
aagcaaacgatggaaatccatcacagcaaacatcaccaggcctacgtcaataatactaat
gcagcgctggagtcctgccctgaatttgccagcttgtctgttgaagaactgatcaccaaa
ctggaccaggtgccagctgagaagaaaaccgcactgcgtaacaacgcaggtggacatgcc
aaccactgcctgttttggaaaggtctgaaacttggcaccaccctgacgggtgatctgaaa
gccgctatcgagcgtgacttcggcagtgttgatgctttcaaagaaaaatttgaacaggct
gcggctacccgttttggttctggctgggcatggctggtactgaaagctgatggtaaattg
gccattgcttctaccgctaatcaggatagtccgctgatgggtgaagccatttcaggtatc
tctggctaccctatcctgacactggatgtgtgggaacacgcctactatctgaagttccag
aaccgccgcccagactacatcaagtcattctggaacgtggtgaactgggacgaagcagcc
aaacgcttcgctgaagccagcaaataa

DBGET integrated database retrieval system