KEGG   Serratia sp. MYb239: CLM71_20760Help
Entry
CLM71_20760       CDS       T05477                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
serm  Serratia sp. MYb239
Pathway
serm00250  Alanine, aspartate and glutamate metabolism
serm00410  beta-Alanine metabolism
serm00640  Propanoate metabolism
serm00650  Butanoate metabolism
serm01100  Metabolic pathways
serm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLM71_20760
   00650 Butanoate metabolism
    CLM71_20760
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLM71_20760
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLM71_20760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:serm01007]
    CLM71_20760
Enzymes [BR:serm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CLM71_20760
Amino acid related enzymes [BR:serm01007]
 Aminotransferase (transaminase)
  Class III
   CLM71_20760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVJ19393
UniProt: A0A2R3H615
LinkDB All DBs
Position
complement(4364087..4365352)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQQATPRGVGVMCGFYAERAENATLWDVEGNQVIDFAAGIAVLNTGHRHPK
VVAAIEQQLQAFTHTAYQIVPYESYVTLAERINQRAPIDGPCKTAFFTTGAEAVENAVKI
ARAHTGRPGIITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALHGVSTQ
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFMQALRTLCDEHGILLVADEV
QTGFARTGKLFAMEHYDIKPDLITMAKSLAGGMPLSAVTGRADVMDAPAPGGLGGTYAGN
PLAVAAAHAVMDVIDEEQLCQRAQRLGHHLVEVLQQARATCPAIAEIRAQGSMVAVEFND
PASGQPSAEFTRQVQQKALQEGLLLLSCGVHGNVIRFLYPLTIPEEQFTEALGILSRALG
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaaccaacgtcgtcagcaagccacgccacgcggggtgggagtt
atgtgtggtttttacgcagagcgggcggaaaacgccaccctgtgggatgtggaaggcaat
caagttatcgatttcgcggccggcatcgccgtgctgaataccggtcaccgtcatccgaaa
gtggtggcggccattgaacaacagctgcaggcctttacccataccgcctaccagattgtg
ccgtatgaaagctatgtcacattggcggaacgcatcaaccagcgtgcgccgatcgacggg
ccgtgtaaaaccgccttcttcactaccggcgccgaggcggtagagaatgcggtgaagatc
gcccgcgcccataccggtcgtccgggcattatcacctttggcggcggcttccatggccgt
acctatatgactatggcgctgaccggcaaagtggcgccgtacaaactgggctttggcccg
ttccccggctcggtgttccacggccagtacccgaacgcgctgcacggcgtcagcacgcag
gatgcgatgaacagcctggagcgcatcttcaaggcggatatcgacccgaaacaggtggcg
gcaatcgtgctggaaccggtgcagggtgaaggcggtttcaacgtcgcgccggcggaattt
atgcaggcgctgcgcacgctgtgcgatgaacacggcatcctgctggtggctgacgaagtg
cagaccggcttcgcccgcaccggcaagctgttcgccatggaacattacgacatcaaacca
gacctgatcaccatggcgaaaagtctggcgggcggcatgccgctgtcggcggtgacaggg
cgcgctgatgtaatggacgcgccggcgccgggcgggctgggcggcacttacgccggcaac
ccgctggcggtggccgcagcgcatgcggtgatggacgtgattgacgaagagcagctgtgc
cagcgcgcgcagcgtctgggccatcatctggtggaagtgctgcaacaggcgcgggccacc
tgcccggccatcgccgagatccgcgcgcagggatcaatggtggcggtcgagtttaacgat
cctgccagcggccagccgtcggcggaatttacccgccaggtacagcaaaaagccctgcag
gaaggcctgctgctgctgagctgcggcgtacacggcaacgtgatccgcttcctgtacccg
ctgaccattcctgaagagcaattcaccgaggcgctgggcattctctcccgcgcgctgggc
gaataa

DBGET integrated database retrieval system