KEGG   Salmonella enterica subsp. arizonae: SARI_01506
Entry
SARI_01506        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ses00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SARI_01506
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ses01001]
    SARI_01506
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ses02022]
    SARI_01506
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SARI_01506
Protein kinases [BR:ses01001]
 Histidine kinases
  OmpR family
   SARI_01506
Two-component system [BR:ses02022]
 OmpR family
  RstB-RstA
   SARI_01506
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: ABX21402
UniProt: A9MRU9
LinkDB
Position
1465477..1466778
AA seq 433 aa
MKKLFVQFYLLLFVCFLVMTLLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPR
EWGKTLKEMDLNLSFDLRVEPLNHYKLDAATAQRLREGDIVALDDQYTFIQRIPRSHYVL
AVGPVPYLYFLHQMRLLDIALMALIAFSLAFPVFIWMRPHWQEMLRLESAAQRFGEGHLT
ERLHFDNGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSENL
TPPESQALNRDIGQLEALIEELLTYARLDRPQNELMLTEPDLPAWLSAHLQDVQSVNPER
AVNLHTCATGNYGALDMRLMARVLDNLLNNALRYSHSTVQVSLLLDGSQATLIVEDDGPG
IEADARERIFEPFVRLDPSRDRTTGGCGLGLAIVHSIALAMGGSVACDDSELGGAKFIFH
WPVWHAIPGMAAA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaagctgtttgtgcaattttatcttctgctgttcgtctgttttctggtcatgacg
ttattggtcgggctggtgtacaaattcaccgccgaacgcgcgggaaggcaatcgcttgac
gatttgatgaaaagttcgctgtatctgatgcgcagcgaactgcgggaaattccgccgcgt
gaatgggggaaaacgctgaaagagatggacctgaacctctcgttcgatttacgcgttgaa
ccgttaaaccactataaacttgatgccgccaccgcacagcgactgcgtgaaggcgatatt
gtcgcgcttgacgatcaatacacctttattcaacgtatcccacgcagccattatgtactg
gcggtcggcccggtgccctatctctatttcctgcatcaaatgcggctactggatatcgct
ttaatggcgctcatcgctttttctctcgccttcccagtatttatctggatgcgaccgcac
tggcaagagatgctcaggcttgaatccgccgcgcagcgctttggcgagggtcatttgact
gaacgcctgcatttcgataatggttccagctttgaacgtctgggcgtggcgttcaaccaa
atggcagataatattaacgccctgatcgccagtaaaaaacagctaattgacggtatcgcc
catgagcttcgcactccgctggtacgtttacgctaccggcttgaaatgagtgaaaacctg
acgccgccggagtcgcaggcgctaaatcgcgatattggtcaactggaagcgctgattgaa
gagctacttacctatgcgcgccttgatcggccacaaaatgaactgatgctaacagaaccc
gatctccccgcctggttgagtgcgcatttgcaggatgtgcagagcgttaacccagaacgc
gccgtaaaccttcacacatgcgcaacaggtaattatggcgcgcttgatatgcgcttaatg
gcgcgggtgctggacaacctgctgaacaatgcgttgcgttacagtcattccaccgttcag
gtcagtctgttactcgacggaagtcaggcaacgctgattgtcgaagatgatggccccggc
attgaagcagatgcgcgagaacgcatatttgaaccttttgtcagactcgaccccagtaga
gaccggactacaggcggctgcgggcttgggctcgccatcgtacactctatcgcgctggcg
atgggcggtagcgtcgcctgtgacgatagcgagctgggcggcgcaaaatttatctttcac
tggccggtctggcacgcgattcccggcatggccgctgcctga

DBGET integrated database retrieval system