KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_2180Help
Entry
STBHUCCB_2180     CDS       T01741                                 

Definition
(GenBank) Penicillin-sensitive transpeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STBHUCCB_2180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sex01003]
    STBHUCCB_2180
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sex01011]
    STBHUCCB_2180
Enzymes [BR:sex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     STBHUCCB_2180
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STBHUCCB_2180
Glycosyltransferases [BR:sex01003]
 Polysaccharide
  Bacterial polysaccharide
   STBHUCCB_2180
Peptidoglycan biosynthesis and degradation proteins [BR:sex01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   STBHUCCB_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PBP1_TM UB2H Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: AEZ43978
LinkDB All DBs
Position
225332..227854
Genome map
AA seq 840 aa AA seqDB search
MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPRKGKGKGRKPRGKRGW
LWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMPVSKNEMV
KLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFSDGRLETIVN
LDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVDTLLATEDRRFYEHDGISL
YSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDR
ILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRN
PKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQAK
LGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKKQRKLSDLETAMVVVDRFSGEVR
AMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNLYRLNTWIADAPISLRQPNG
QVWSPENDDRRYSESGKVMLVDALTRSMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNP
VPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQ
AAYLTLWTMQQVVQRGTGRQLGAKYPGLHLVGKTGTTNNNVDTWFAGIDGSQVTITWVGR
DNNQPTKLYGASGAMAIYQRYLANQTPTPLVLTPPEDVVDMGVDYDGNFVCNGGMRTLPV
WTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQPQQPAQQQPPKEEKSDGVAGWIKEMFGGN
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccgattggacgtaaggggaaaccgtcacgtcctgtgaaa
caaaaggtgagccgtcgtcggcagcatgacgacgattatgatgatgactatgaggatgaa
gaaccgatgccgcgtaaaggtaagggcaaagggcgtaagcctcgtggcaagcgcggctgg
ctgtggctattgctaaaactgtttatcgtttttgtggtgctgttcgccatttacggcgtc
tatctggatcaaaaaatccgcagccgtattgatggcaaggtctggcagcttccggcggcg
gtatatggccggatggtgaaccttgagccagacatgcctgtcagcaaaaacgagatggtg
aaattgctggaagcgacgcagtatcgtctggtgacgaagatgacccgtcccggcgaattt
accgtgcaggccaatagcattgagatgatccgtcgtccgtttgacttcccggacagcaaa
gaagggcaggtgcgcgcgcggctgacgttcagtgacgggcgtctggaaaccatcgtcaat
ctggataacaaccgccagtttggcttcttccgcctcgatccgcggcttatcaccatgctt
tcttcgccaaatggcgagcagcgtttattcgtcccgcgcagcggtttcccggatctgctg
gtcgatacgctgttggcgacggaagaccgtcgtttctatgagcatgatggcattagtctt
tactctatcgggcgtgcggtgctggccaacctgacggcgggacgcacggtgcagggggcc
agtacgctgacccagcagctggtgaagaacctgttcctctccagcgaaagatcatactgg
cgtaaagcgaatgaagcctacatggcgctgatcatggatgcccgttacagtaaagatcgt
attcttgagctgtacatgaacgaggtctacctcggtcaaagcggggataatgaaattcgc
ggttttccgctggcgagcctgtattactttggtcgtccggtagaggaactgagcctcgat
cagcaggcgttactggtggggatggtaaaaggggcgtcgatttataacccgtggcgtaac
ccgaaactggcgctggagcgtcgtaacctagtgttacgcctgttacagcagcagaaaatc
atcgatcaggaactctatgacatgctgagcgcgcgtccgcttggcgtacagccgcgcggc
ggcgttatttcaccgcagccagcgtttatgcagatggttcgtcaggaactgcaggcgaag
ctgggggataaaattaaagatctctccggcgtgaagatcttcaccacctttgactccgtg
gcgcaggatgccgcagaaaaagccgttgtcgaaggcattccggcgttgaagaagcagcgt
aaattgagcgatctggaaactgcgatggtggtagtggatcgctttagcggcgaggtacgc
gcgatggttggcggggcggagccgcagtatgctggctataaccgtgccatgcaggcacgc
cgttccatcgggtcgctggcgaaaccggcgacctatctgaccgcgttaagtcagccgaac
ttataccgtctgaacacctggattgccgatgcgccgatttctctgcgccagccgaatggt
caggtctggtcgccggagaacgacgatcgtcgctacagcgaaagcgggaaagtgatgctg
gtggatgcgttaactcgttcaatgaacgtaccgacggtcaatctggggatggcgttaggt
ttaccggcggtaaccgatacctggacgaagctcggcgtgccgaaagatcagctcaatccg
gttccggcgatgctgttaggggcgctgaacctgacgccgatcgaagtggcgcaagcgttc
cagactatcgccagcggcggaaatcgcgcgccgttatcagcgctgcgttcggttattgcg
gaagatggtaaagtgctgtaccaaagttatccgcaagctgaacgcgccgtaccggcacag
gcggcttacctgacgctctggacaatgcagcaggtcgtccagcgtggtacggggcgtcag
cttggcgcgaaatatccgggtctgcatctggtgggtaaaaccgggacgacaaacaacaat
gtcgatacctggtttgccggtatcgacggcagccaggtgactatcacctgggtaggccgt
gataacaaccagccaacgaaattgtacggtgccagcggcgcgatggcgatttaccagcgc
tatctggcgaaccagacgccgacgcctttagttctgacgccgccggaagatgtggtggat
atgggcgttgattacgacggtaattttgtctgtaacggcggtatgcgcactctgccggtc
tggacggacgatccaaatacgctgtgccagcagggcgagatgatgcagcagcaacagcag
ccgtcaggcaatccgttcgatcagtcgtctcagccgcagcagcctgcgcagcaacagccg
ccgaaagaagagaagagcgacggcgttgccggctggattaaggagatgtttggcggcaat
taa

DBGET integrated database retrieval system