KEGG   Streptomyces pratensis: Sfla_2451Help
Entry
Sfla_2451         CDS       T01647                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00564  Glycerophospholipid metabolism
sfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sfla_2451
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Sfla_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADW03880
UniProt: E8W089
LinkDB All DBs
Position
complement(2921228..2922934)
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERTEALAAMAERELDVLVVGAGVVGAGTVLDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSVSSGHGRGLPVHRHLTRRHALRVAPALRKDALVGALQYYDAQMDDARF
VANLVRTAASYGAHVANGARVTGFLREGERVVGARVQDVEGGAEYEIRAKQVVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLNTPLGRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHALDRRVADCVTEDIPLLGAEGYRAL
WNARARIADRTGLHVVRVEHLLNRYGSMTEELLELVKGDSSLGEPLTGAEDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCARECADLMAPVLGWDTDRIEREVEHYRKRV
EAERESQRQPDDLTADAARLGAPDIVPR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgcggagcgcaccgaggcgctggccgcgatggccgag
cgcgaactggacgtgctggtcgtgggagcgggcgtggtaggcgccgggaccgtgctggac
gcggtcaccagaggactttccaccggactggtcgaggcgcgggactgggcgtccggcacg
tccagcaggtcgagcaagctgatccacggcggactgcgctatctggagatgctggacttc
gcgctcgtccgcgaggcgctcaaggagcgcgggctgctcctggagcggctggcgccccac
ctggtcaagcccgttcccttcctctaccccttgcagcacaagggctgggagcggctgtac
gccggctcgggcgtcgcgctgtacgacgcgatgtcggtgtcctcgggacacggccgcggg
ctgcccgtgcaccggcacctcacacgccgccacgccctgcgggtcgctccggccctgcgc
aaggacgccctggtcggagccctgcagtactacgacgcccagatggacgacgcgcggttc
gtcgcgaacctcgtgcgcacggccgcgagctacggcgcacacgtggcgaacggggcgcgg
gtgaccggtttcctgcgggagggcgagcgggtcgtcggcgcgcgggtgcaggacgtcgag
ggcggcgccgagtacgagatccgggccaagcaggtcgtcaacgcgaccggcgtgtggacc
gacgacacccaggccctcatcggcgagcgcgggcagttccacgtccgggcgtcgaagggc
atccacctcgtcgtgcccaaggaccgcatccactcgtcgaccggactcatcctgcggacc
gagaagtccgtgctcttcgtgatcccgtggggacggcactggatcatcggcacgaccgac
accgactgggacctggacaaggcccacccggcggcctccagcgccgacatcgactatctg
ctcgaacacgtgaactcggtgctcaacaccccgctcggcagggacgacgtcgagggcgtc
tacgccgggctccggcccctgctggccggtgagtcggacgccaccagcaagctctcgcgg
gaacacacggtggcccacccggcgccgggactcgtcgtcgtggcgggcgggaagtacacg
acgtaccgggtgatggcgaaggacgccgtcgacgaggccgtgcacgcgctcgaccgacgg
gtggcggactgcgtcaccgaggacatcccgctgctgggggccgagggctaccgcgccctg
tggaacgcccgcgccaggatcgccgaccgcaccgggctgcacgtcgtccgggtggagcac
ctgctcaaccgctacggctcgatgaccgaggaactcctcgaactcgtgaagggcgactcg
tcgctgggagaacccctcacgggcgccgaggactacctgcgcgccgaggtcgtctacgcc
gcctcgcacgagggtgcccgccacctcgacgacgtcctgacccggcgcacccggatctcc
atcgagaccttcgaccggggcacccgctgtgcccgcgagtgcgcggacctgatggcaccg
gtgctcggctgggacaccgaccggatcgaacgggaggttgagcactaccgcaagcgcgtg
gaggccgagcgtgagtcccagcggcagccggacgacctgacggccgacgcggcgcggctg
ggggcgccggacatcgtgccgcgctga

DBGET integrated database retrieval system