KEGG   Streptomyces pratensis: Sfla_3455Help
Entry
Sfla_3455         CDS       T01647                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00250  Alanine, aspartate and glutamate metabolism
sfa00410  beta-Alanine metabolism
sfa00430  Taurine and hypotaurine metabolism
sfa00650  Butanoate metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa02024  Quorum sensing
Module
sfa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Sfla_3455
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfla_3455
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfla_3455
   00430 Taurine and hypotaurine metabolism
    Sfla_3455
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Sfla_3455
Enzymes [BR:sfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sfla_3455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ADW04875
UniProt: E8WG52
LinkDB All DBs
Position
complement(3992802..3994226)
Genome map
AA seq 474 aa AA seqDB search
MALHQGRHGRPAPSEEHRRLALNPFFGEADPTAPMVAAPPTHRLPEDPLPPSTAYRLVHD
ELMLDGNSRLNLATFVTTWMEPQAGVLMSECRDKNMIDKDEYPRTAELERRCVAMLADLW
NAPDPASTVGCSTTGSSEACMLAGMALKRRWSARNADRYPATARPNLVMGVNVQVCWEKF
CTFWEVEPRQVPMDGERFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALDD
LQERTGLDIPVHVDGASGAMIAPFLDPDLVWDFRLPRVSSINTSGHKYGLVYPGVGWALW
RSQAELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQASRDI
ARRLAVQFEALEDFRLLTRGDELPVFAVTTKPDVQAYDVFDVSRRLRERGWLVPAYTFPA
NRQDLSVLRVVCRNGFSSDLAELLLDDLRGLLPELRSQAHPLHRDPGVQTAFHH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccaccagggacggcacggccggcccgccccctccgaggaacaccgcagactc
gccctcaacccgttcttcggggaggccgacccgaccgcgcccatggtcgcggcgccgccg
acgcaccggctcccggaggatccgctgccgccgtcgaccgcctaccggctcgtccacgac
gagctgatgctcgacgggaactcccggctcaacctcgccaccttcgtcaccacctggatg
gaaccccaggcgggtgtgctgatgagcgagtgccgggacaagaacatgatcgacaaggac
gagtacccccgtaccgccgagctggagcggcgctgcgtggcgatgctcgccgacctctgg
aacgcgcccgatcccgcctccacggtgggctgttcgacgacggggtccagcgaggcctgc
atgctcgcggggatggcgctgaagcggcgctggtcggcgaggaacgccgaccgctatccg
gcgacggcacggcccaacctggtgatgggcgtcaacgtgcaggtctgctgggagaagttc
tgcacgttctgggaggtcgagccacgccaggtcccgatggacggtgagcgtttccacctg
gacccgcaggcggccgccgagctgtgcgacgagaacaccatcggggtcgtcgggatcctc
ggttccaccttcgacggctcctacgagccgatcgccgacctctgcgccgcgctggacgac
ctccaggagcgcaccgggctcgacatcccggtccatgtggacggcgcgtccggggcgatg
atcgccccgttcctcgacccggacctggtctgggacttccggctgccccgggtgtcctcg
atcaacacctccggacacaagtacggcctggtctacccgggtgtggggtgggccctgtgg
cgatcacaggccgagctgccggaggagctggtcttcagggtcaactacctgggcggcgac
atgccgaccttcgcgctgaacttctcccggcccggcgcgcaggtggtcgcgcagtactac
acgttcctgcggctgggccgggagggctaccgggccgtgcagcaggcctcccgggacatc
gcgcgacggctcgccgtgcagttcgaggccctggaggacttcaggctcctgacccgcggc
gacgaactcccggtgttcgcggtgacgacgaagcccgacgtccaggcgtacgacgtcttc
gacgtgtccagacggctgcgggagcgcggctggctcgtgcccgcgtacaccttccccgcc
aaccgccaggacctctcggtgctgcgggtcgtctgccgcaacggcttctcctccgacctc
gcggagctgctgctggacgacctgcgggggctgctgcccgaactgcgctcccaggcgcat
ccgttgcaccgggatcccggggtccagacggcgttccaccactga

DBGET integrated database retrieval system