KEGG   Streptomyces pratensis: Sfla_3922Help
Entry
Sfla_3922         CDS       T01647                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
sfa  Streptomyces pratensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Pkinase_fungal TFIIA
Motif
Other DBs
NCBI-ProteinID: ADW05338
UniProt: E8W5H0
LinkDB All DBs
Position
4535993..4537615
Genome map
AA seq 540 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVAGQPGETVAIKVLKEELANDADV
VMRFLRERSVLLRLTHANIVRTRDLVVEGDLLALVMDLVDGPDLHRYLRENGPLTPVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLDERDGEMHPMLTDFGIARLADSPGLTRTHE
FVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGGTALEVLHRHLSEEPRR
PGNVPEPLWTVIERCLRKDPDQRPSAVNLARALRTVGEGVGVHANSAQIAAAEGVGALLA
PDPAPAAVPDTPGAADATQVLPSNAGSYDPAAPTSVMRQTPGGGGQADPTAMLPPVPPRP
DGPPRPDEPHPWQSQLRAARDRNEQTQVQYLDPSQDPLRRRPQRQQPPQAQQPPQAQQRR
QPQRAQQQPQRYQQPHQPQQQQRQQYAPPQQPAPQPPAPRQPRQRSANPMRIPGLGCLKG
CLFSVVLLVVAAWLIWELTPLQDWVAQGQSFWDAIGDGIDNVTKWFENLGGSDSGGTPGQ
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggcagcaagtacctgctcgaggagccgctcggacgcggcgccacgggc
accgtctggcgagcccgccagcgggagaccgcgggcgccgaggcggccgtcgccgggcag
cccggcgagaccgttgcgatcaaggtgctcaaggaggagctcgccaacgacgcggatgtc
gtcatgcggttcctgcgtgagcgctcggtgctgctgcggctcacccacgcgaacatcgtg
cgcacccgcgacctcgtcgtcgagggcgatctcctcgccctggtgatggacctggtcgac
ggccccgacctgcaccgctacctccgcgagaacggcccgctcaccccggtcgccgccgcg
ctgctcaccgcgcagatcgcggacgcgctggccgcgagccacgcggacggtgtcgtgcac
cgcgacctgaagcccgccaacgtgctgctcgacgagcgcgacggcgagatgcacccgatg
ctcaccgacttcggcatcgcgcgcctcgcggactccccgggcctgacccggacccatgag
ttcgtcggcacgcccgcctatgtggcgcccgagtcggccgaaggccgtccgcagacctcc
gccgtggacatctacggcgccggcatcctgctctacgaactggtcaccggccgcccgccg
ttcgccgggggcaccgcgctggaggtcctgcaccggcacctcagcgaggagccccgccgc
cccggcaacgtgcccgagccgctgtggacggtgatcgaacgctgcctgcgcaaggacccg
gaccagcggcccagcgccgtgaacctcgcccgtgcgctgcgtaccgtcggcgagggcgtc
ggggtgcacgcgaactcggcgcagatcgccgccgccgagggcgtgggcgccctgctcgcc
cccgacccggcgcccgccgccgtcccggacaccccgggcgccgcggacgcgacccaggtg
ctgccgagcaacgccggttcgtacgaccccgccgctccgaccagcgtgatgcggcagact
cccggcggaggcggccaggccgatccgaccgcgatgctgccgcccgtaccgccgcgcccc
gacggccccccgcggcccgacgagccgcacccctggcagtcccagctccgggccgccagg
gaccgcaacgagcagacgcaggtccagtacctcgatccgagccaggacccgttgcgccgt
cgcccccagcgccagcagccgccgcaggcgcagcagccgccccaggcccagcagcgccgg
cagccccagcgcgcccagcagcagccccagcgctaccagcagccgcaccagccacagcag
caacagcggcagcagtacgcgcccccccagcagcccgcgccccagccgcccgccccgcga
cagccgaggcagcgcagcgccaacccgatgcgcatccccggcctcggctgcctcaagggc
tgcctgttctcggtggtgctgctggtcgtcgccgcctggctcatctgggaactcacgccg
cttcaggactgggtcgcccaggggcagagcttctgggacgccataggggacggcatcgac
aacgtcaccaagtggttcgagaacctcggcgggagcgactccggcggtacgcccggtcag
taa

DBGET integrated database retrieval system