KEGG   Spirochaeta africana: Spiaf_0914
Entry
Spiaf_0914        CDS       T01811                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
sfc  Spirochaeta africana
Pathway
sfc00620  Pyruvate metabolism
sfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spiaf_0914
Enzymes [BR:sfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     Spiaf_0914
SSDB
Other DBs
NCBI-ProteinID: AFG37003
UniProt: H9UHL0
LinkDB
Position
1052372..1055875
AA seq 1167 aa
MTTIEQDIGMTRDITDPQEHGRIQRYINLKLASLGLPVSRAVESHDLDIAHDLIEHYIEK
NRLLAEYQCPIDARLQAYIDDLLQDAGIDRPVIPTETVILDRYGLARTLSLPPDRDEFIT
DIVESYRVKQGVLHNPKHDRRTTKGSFHVAEGGLPVPPDKKSVPLATYGRLLQHAFTPPR
DLMELPFTASQENTAASFVSLMLKPMVSPEVAGYSNKKYLEVRFLAPGNLVSNLDFVESI
FGNAGDPYLPENDSGLDPEHWTGHTGMAILAPHLIRLTKKELGLPNSKDATERQKRDGMC
WDKPDELYNDGMPFKITSRDQRGVIITIIADNYFGYSKKEVKAQISYSANLCGMYEEEHA
GGALAFASYNLGVRFLPDSLTKTRNQSFDDVVRLMGDTVYVFPEGYARDKTYPSIFYLPE
DARIYLDTQEAVWQRNGEEQRMQVLPDNVYLHPSGYKVRLEKHPSTPAWRLVGTDAEGVL
CHKPCTVSGGGKSEISKSIWDAIQFGPVFISDFEQDMDEVARVFAHDYSQRFDPDADLDS
LPPEAFPKFKGGKEALSRKNGLLDPSISLGFVINLLSPSSAWSDSYNQWIDSIPNSIKAL
AFLIKRFYRQSWGDDWRSHFSVDTINGLPGHEIRYGGRKLQGSYLRIGSRVDGSGWTFKL
RQDCMPADKVQWEDDISASVVVPADQIHGLNPLYRNPSVKFVENCEYRLFQRPDDAIHRG
YDKQAEGDMAQDGNFLCNFAPLKQSEAREFMHRAVEYYEYTQPMQDLIRRTAEDSSCAYF
SVSSHPRIVDGTPTKNPRYLQTNPNLVRPRDRYLADISTRLARMVPIDQPVHHPVNAVLP
GRRNNPADHKAGIRPLAVYNPIHYQELPELFMDFVASLTGKSPSTTGAGSEGPLTKGPFN
ALVATSDLNNALLSYILTGYHAFTTAAGYIGHKYKVDHDISLLMPEIWCRMTPDELDPQR
LIELGYLEKVESFTHAGREIPASRLGYRITKDFCNAFLGRIFDHPETVFSEEMLKPEIQS
IDDYADGIMNIVEAQRKVARSFLEDSSDEAAIPPLRALLHIMAEGSYQGKTEQDPEIRRL
FDREYVLQSDWYQDRLSRLQQGRVALYERHIAYLKEFAHKSRHEDEVKRLAIDQRIEAAE
HHLSRVRDPQFLQTINGTLGLDPLFTG
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgactactattgaacaggatattggcatgaccagggatatcaccgatccgcaggagcat
ggccgtattcaacgctacatcaacctgaagcttgcttcactgggtctgccggtatcacgg
gcagtcgagtcgcatgatctggatatagcccatgacctgattgagcactatatcgagaag
aatcggctgctggcggagtatcagtgtccgatcgatgcccggttgcaggcttacatcgat
gacctgctgcaggatgccgggattgatcgcccggttatcccgaccgaaaccgttatcctg
gatcgatacggcctggcgcgcaccctgtcgctgccgccggatcgcgacgagtttatcacc
gacatagtggaaagctaccgggtaaagcagggggttctgcataacccgaaacatgatcgt
cgcaccaccaagggatcatttcatgttgccgagggcggcctgccggtaccgccagacaag
aaatcggtaccgctggcaacctacgggcgactgctgcagcatgcctttaccccgccacgg
gatctgatggagctgccgtttaccgcctcgcaggagaacaccgcagcgtcttttgtatcg
ctgatgctcaagccgatggtcagtcccgaggttgccgggtacagcaacaagaagtacctc
gaggtacggtttctggcgccgggaaatctggtaagcaatctcgattttgtcgagtccatc
ttcgggaatgccggggatccctatctccccgagaacgattccgggctcgaccccgaacac
tggaccggtcacaccggtatggccattctggcaccgcatctgatccggcttaccaaaaaa
gagctggggctgccgaacagcaaggatgctaccgagcggcagaaacgcgacgggatgtgc
tgggacaagccggatgaactctataacgatggtatgccgttcaagataaccagtcgggat
cagcgcggggttatcataaccattattgccgacaactatttcggctactccaaaaaagag
gtcaaagctcagatcagttactcggcaaatctctgtgggatgtacgaggaggagcatgcc
ggtggagcactggcgttcgccagctacaacctcggggttcggttcctcccggacagcctt
accaagacccgcaatcagagtttcgatgatgtagtgcggctgatgggggatacggtctac
gtcttcccggaaggctatgcccgggacaaaacctatccctctatcttttacctgcccgag
gatgcccgcatttacctggatacgcaggaggcggtctggcagcgtaacggcgaggagcag
cggatgcaggtactgccggacaatgtctacctgcatccctccggctacaaggttcgactt
gaaaagcacccctcaaccccggcctggcgtctggtgggtaccgatgccgaaggggtgctg
tgccataagccctgcaccgtcagcggcggcggcaaatccgagatttccaaatccatctgg
gatgctatccagtttggcccggtattcatctctgattttgagcaggatatggacgaggtt
gcccgggttttcgcgcacgactacagccagcgattcgatccggatgccgaccttgacagt
ctgccgcccgaggcattcccgaagttcaagggcgggaaagaggccctgtcacgcaagaac
gggctgctggatccatcgatcagcctgggatttgtgatcaatctgctcagtccctcatcg
gcctggtcagattcctacaatcagtggatcgactccatcccgaactccatcaaggccctg
gcatttctgatcaagcgattctatcgacagagctggggggatgactggcgcagccacttc
agtgtagataccatcaacgggctgccggggcacgagatccgctacggtggacgcaagctg
caaggcagctatctccggattggctcgcgtgtggatggcagcggctggaccttcaaactg
cgacaggactgtatgccggccgacaaggtacagtgggaagacgacatctcggcatcggta
gtggtgccggctgatcagatccacggattgaatccattgtatcggaaccccagtgtaaaa
tttgtagagaactgtgagtaccgccttttccagcgacccgatgatgcgatccatcgcggg
tatgacaagcaagccgagggagacatggcacaggacgggaattttctgtgcaactttgcc
cccctcaagcagtcagaagcacgagagttcatgcatcgcgccgtcgagtactatgagtac
acccagccgatgcaggacctgatccgccggaccgccgaggacagcagttgtgcctacttc
tcggttagcagtcatccccgcattgtagacggcacgccaaccaagaacccgcgatatctg
caaaccaatcccaacctggtgcgtccccgcgaccgctatctggctgatatctctacgcgc
cttgctcgaatggtgcccatcgatcagccggtgcatcacccggtaaatgccgtactgccc
gggcgacggaacaatccggcggaccacaaggccggtattcgcccgctggcagtatacaac
ccgattcattatcaggagctgcctgaactgttcatggattttgtggccagcctgaccggc
aagagcccctccacaaccggagccggctccgagggcccgctgaccaaaggaccctttaat
gcactggtggccacctctgatctgaacaatgcattgctcagctacatcctgaccgggtac
catgcctttaccaccgctgccgggtacatcggacacaagtacaaggttgaccatgacatc
agcttgctgatgcccgagatctggtgccgcatgaccccggatgaactggatccgcagcgc
ctgatcgagctgggctatctggaaaaggtcgagagctttactcacgcagggcgtgagatc
ccggcatcgcgtctcggctaccggattaccaaggacttctgcaatgcctttctggggcgt
atctttgatcatcccgaaaccgtgttcagcgaggaaatgctcaaaccggagatacagagc
attgatgattatgcagacggtatcatgaatatcgtagaggcacagcgcaaggtcgcccgg
agctttctggaagacagctcggacgaggccgctatccccccgctgcgagcgctgctgcat
atcatggccgagggcagctatcaaggtaaaaccgagcaggatcccgagatccgtcgcctg
tttgatcgcgagtatgtcctgcagtcggactggtatcaggaccgcctgagccgcctgcag
cagggcagggtagcgctgtatgaacgacatatcgcctatctcaaggagtttgcacacaaa
tcacggcatgaggatgaggtgaaacgcctggcaatcgatcagcgcatcgaggcagccgag
caccatctgagccgggtcagggatccacagttcctgcagacgataaacggtacactgggt
ctggatccgctgtttaccggctga

DBGET integrated database retrieval system