KEGG   Serratia fonticola GS2: AV650_26795Help
Entry
AV650_26795       CDS       T04716                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00250  Alanine, aspartate and glutamate metabolism
sfg00410  beta-Alanine metabolism
sfg00640  Propanoate metabolism
sfg00650  Butanoate metabolism
sfg01100  Metabolic pathways
sfg01120  Microbial metabolism in diverse environments
Module
sfg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AV650_26795
   00650 Butanoate metabolism
    AV650_26795
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AV650_26795
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AV650_26795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfg01007]
    AV650_26795
Enzymes [BR:sfg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AV650_26795
Amino acid related enzymes [BR:sfg01007]
 Aminotransferase (transaminase)
  Class III
   AV650_26795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALX96918
UniProt: A0A0U4IU30
LinkDB All DBs
Position
complement(5870762..5872027)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRLAATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIEKQLQAFTHTAYQIVPYESYISLAERINQRAPIEGTCKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVSTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFMQALRTLCDQHGILLIADEV
QTGFARTGKLFAMDHYAVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIEEEQLCQRSQRLGQHLVEVLQQARGHCPAIVDIRALGSMVAVEFND
PATGKPSPEFTRQVQQKAQEEGLLLLSCGVNGNVIRFLYPLTIPDAQFNQALAILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgtctggccgctaccccaagagggattggcgtg
atgtgtggtttttacgccgagcgtgcagaaaatgccaccctgtgggatgtggaaggcaat
gaggtgatcgacttcgcctcgggcattgcggtgctcaataccggtcaccgtcatcccaag
gtgatcgccgccattgaaaagcaactgcaggcgtttacccatacggcataccagatcgtg
ccttatgagagctatatttcgctggccgagcgtatcaaccaacgtgctccgatcgaaggc
acctgtaaaaccgccttcttcaccaccggtgcagaagcggtagaaaatgcggtgaagatc
gcccgtgcttacacagggcgtccaggcctgatcaccttcggcggcggattccatggccgt
acctatatgaccatggcgctgacgggtaaagtggccccttacaagctgggctttggcccg
ttccctggctccgtgttccacggtcagtatccgaatgcgttatatggcgtcagcaccgaa
gatgccatgaacagcctggagcgcatctttaaagccgatatcgatcccaagcaggttgcc
gcgatagtgctggagccggtgcagggtgaagggggctttaacgtggctccggcagaattc
atgcaggcgttgcgtacgctgtgtgaccaacacggtatcctgctgatcgccgatgaggtg
caaaccggctttgcccgtaccggcaagctgtttgcaatggaccactatgcggtgaaaccg
gacctgatcaccatggcgaagagcctggctggcggtatgccgctatctgccgtggcgggc
cgtgctgaagtgatggatgccccggcccccggtggccttggcggtacctacgccggtaac
ccattagccgttgctgccgcgctggcggtcttggacgtgattgaagaagaacagctgtgt
caacgctcccagcgtttggggcaacatttggtggaagtgctgcaacaggcacgtggccac
tgcccggcgattgtggatattcgcgcgctgggctccatggtggcagtagagttcaacgac
ccggcaaccggtaaaccgtcgccggagtttactcgtcaggtacagcaaaaagcccaggaa
gaagggctgttgctactcagctgtggggtgaatggtaacgtgatccgtttcctgtacccg
ctgaccattcctgatgcccagtttaaccaggcgctggcaatcctttcccgtgcgctggcc
caataa

DBGET integrated database retrieval system