KEGG   Streptomyces fulvissimus: SFUL_4581Help
Entry
SFUL_4581         CDS       T02650                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00564  Glycerophospholipid metabolism
sfi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SFUL_4581
Enzymes [BR:sfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SFUL_4581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AGK79477
UniProt: N0D2L3
LinkDB All DBs
Position
5031000..5032781
Genome map
AA seq 593 aa AA seqDB search
MDMGGRPLGRVALPCPTTPIHREAAVRTATLGPAERTAALAAMAERELDVLVVGAGVVGA
GTVLDAATRGLSTGLVEARDWASGTSSRSSKLIHGGLRYLEMLDFALVREALKERGLLLE
RLAPHLVKPVPFLYPLQHKGWERLYAGSGVALYDAMSVSSGHGRGLPVHRHLSRRHALRV
APALKKDALVGALQYYDAQMDDARFVTELVRTAASYGAQVANRARVIGFLREGERVVGAL
VQDVEGGKEYEVRAKQVVNATGVWTDDTQGLIGERGQFHVRASKGIHLVVPKDRIHSATG
LILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADIDYLLEHVNSVLNTPLTRD
DVQGVYAGLRPLLAGESDATSKLSREHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVH
GLDQRVAACVTEDTPLLGAEGYKALWNARARIAARTGLHVVRVEHLLNRYGSMTEEILEL
ILADPTLGEPLPAADDYLRAEIVYAASHEGARHLDDVLTRRTRISIETFDRGTRSARLCA
ELMAPVLGWDEGQIDREVEHYEKRVEAERESQRQPDDLTADAARLGAPDIVPI
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtggacatgggcggccggcccctcggccgggtggcactcccgtgtccgaccaccccgatc
caccgggaggcagcagtgaggacagcgacactgggacccgccgagcgcaccgccgcgctc
gccgccatggccgagcgcgaactggacgtgctggtcgtgggggcgggggtcgtcggcgcc
gggacggtgctggacgccgccaccagaggactctcgaccggtctggtcgaggcgcgcgac
tgggcgtcgggcacttcgagcaggtcgagcaagctgatccacggggggctgcgctatctg
gagatgctcgacttcgccctggtgcgcgaggcgctgaaggagcgcggactcctgctggag
cggctcgccccgcacctcgtgaagccggtgcccttcctctacccgttgcagcacaagggg
tgggagcggctctacgcgggctcaggcgtcgcgctgtacgacgcgatgtcggtctcctcg
ggccacggccggggcctccccgtgcaccgccacctctcccgccgccatgccctgcgggtc
gccccggcgctcaagaaggacgccctggtcggcgccctgcagtactacgacgcccagatg
gacgacgcgcgtttcgtcaccgagctggtccgcaccgccgcctcctacggggcccaggtg
gcgaaccgcgcccgggtgatcggcttcctccgcgagggcgagcgggtcgtgggcgcactg
gtgcaggacgtcgagggaggcaaggagtacgaggtccgggccaagcaggtggtcaacgcg
accggcgtgtggacggacgacacccaggggctcatcggcgagcgcggacagttccacgtc
cgggcctccaagggcatccacctggtcgtccccaaggaccgcatccactccgccaccggc
ctcatcctgcgcaccgagaagtccgtcctcttcgtgatcccctggggcaggcactggatc
atcggcaccacggacaccgactgggacctggacaaggcccacccggccgcctccagcgcc
gatatcgactacctgctcgaacacgtcaactccgtcctcaacaccccgctgaccagggac
gacgtccagggggtctacgccggactgcgcccgctgctggccggtgagtcggacgccacc
agcaagctgtcgcgcgagcacaccgtggcccaccccgcccccggcctggtggtcgtggcg
ggtggcaagtacacgacgtaccgggtcatggccaaggacgcggtggacgaggcggtgcac
gggctcgaccagcgggtcgccgcctgcgtcaccgaggacaccccgctgctgggcgccgag
gggtacaaggccctgtggaacgcgcgggccaggatcgcggcccggaccggcctccatgtc
gtccgggtggagcacctgctcaaccggtacggctcaatgacggaagaaattctggaactg
atcctggccgaccccaccctgggcgaacccctgcccgccgccgacgactacctccgcgcc
gagatcgtctacgccgcatcccacgagggcgcccggcatctggacgacgtgctgacccgg
cgcacccggatctccatcgagaccttcgaccggggcacccgcagcgcccgcctctgcgcg
gagctgatggcaccggtgctgggctgggacgaggggcagatcgaccgggaggtcgagcac
tacgagaagcgggtggaggccgagcgcgagtcgcagcggcagcccgacgacctcacggcg
gacgcggcccggctcggcgctccggacatcgtgccgatctag

DBGET integrated database retrieval system